anti-Horse (Equine) STAT3 antibody for Immunocytochemistry

Recommended STAT3 Antibody (supplied by: Log in to see )

Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3) Antibodies
  • 1110034C02Rik
  • AW109958
  • Aprf
  • APRF
  • HIES
  • Xstat3
  • aprf
  • hies
  • stat3
  • wu:fc15d02
  • wu:fl59g06
  • z-Stat3
  • signal transducer and activator of transcription 3
  • signal transduction and activation of transcription 3
  • signal transducer and activator of transcription 3, gene 1 L homeolog
  • signal transducer and activator of transcription 3 (acute-phase response factor)
  • STAT3
  • stat3
  • Stat3
  • stat3.1.L
AA 688-722
Cow (Bovine), Hamster, Horse (Equine), Human, Monkey, Mouse (Murine), Pig (Porcine), Rat (Rattus)
This STAT3 antibody is un-conjugated
Gel Shift (GS), Immunocytochemistry (ICC), Immunoprecipitation (IP), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Catalog No. ABIN210643
$ 925.83
Plus shipping costs $45.00


Antigen Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3) Antibodies
Epitope AA 688-722
(128), (102), (71), (18), (16), (15), (15), (14), (12), (10), (7), (7), (5), (5), (5), (5), (4), (4), (4), (4), (4), (4), (4), (4), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Cow (Bovine), Hamster, Horse (Equine), Human, Monkey, Mouse (Murine), Pig (Porcine), Rat (Rattus)
(628), (361), (286), (41), (38), (31), (31), (14), (11), (9), (7), (7), (5), (4), (4), (3), (3), (1), (1), (1), (1), (1)
Host Rabbit
(499), (132), (35), (4), (2), (1)
Conjugate This STAT3 antibody is un-conjugated
(27), (23), (19), (15), (12), (11), (7), (5), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application Gel Shift (GS), Immunocytochemistry (ICC), Immunoprecipitation (IP), Western Blotting (WB)
(586), (285), (255), (102), (98), (92), (56), (55), (27), (24), (12), (10), (9), (8), (5), (5), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-STAT3 Antibody

Target Details STAT3 Application Details Handling Images
Specificity Recognizes STAT3 (92kD). A second unknown band at 50kD may be observed with longer exposures or at high concentrations of the antibody. Species cross-reactivity: Human, rat and mouse.
Predicted Reactivity Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Horse, Pig, Opossum (100%) Sheep (97%) Chicken (84%).
Purification Protein A purified
Immunogen Bacterially expressed GST fusion protein corresponding to human STAT3 (aa688-722, RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 amino acids are identical to mouse STAT3B. Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Horse, Pig, Opossum (100%), Sheep (97%), Chicken (84%).

Type of Immunogen: Fusion protein
Isotype IgG
Plasmids, Primers & others

Target Details STAT3

Product Details anti-STAT3 Antibody Application Details Handling Images back to top
Alternative Name STAT3 (STAT3 Antibody Abstract)
Background Name/Gene ID: STAT3

Synonyms: STAT3, Acute-phase response factor, APRF, DNA-binding protein APRF, HIES
Gene ID 6774
UniProt P40763
Pathways JAK-STAT Signaling, RTK Signaling, Interferon-gamma Pathway, Neurotrophin Signaling Pathway, Dopaminergic Neurogenesis, Response to Growth Hormone Stimulus, Carbohydrate Homeostasis, Stem Cell Maintenance, Hepatitis C, Protein targeting to Nucleus, Feeding Behaviour, CXCR4-mediated Signaling Events, Signaling of Hepatocyte Growth Factor Receptor

Application Details

Product Details anti-STAT3 Antibody Target Details STAT3 Handling Images back to top
Application Notes Approved: GS, ICC (10 μg/mL), IP, WB (2 - 4 μg/mL)

Usage: Suitable for use in Western Blot, Immunocytochemistry and Immunoprecipitation. Western Blot: 2-4 μg/mL detects STAT3 in RIPA lysates from EGF stimulated human A431 cells. EGF-stimulated A431 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-STAT3 (2 μg/mL). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system. Immunocytochemistry: 10 μg/mL shows positive immunostaining for STAT 3 in A431 cells fixed with 95 % ethanol, 5 % acetic acid. Immunoprecipitation: 4 μg immunoprecipitates STAT 3 from 500 μg of EGF-stimulated A431 RIPA lysate. Gel Shift Assay: This antibody supershifts.

Target Species of Antibody: Human

Restrictions For Research Use only


Product Details anti-STAT3 Antibody Target Details STAT3 Application Details Images back to top
Format Liquid
Concentration Lot specific
Buffer 0.1 M Tris-glycine,  pH 7.4, 0.15 M sodium chloride, 0.05 % sodium azide, 40 % glycerol.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeat freeze-thaw cycles.
Storage 4 °C,-20 °C
Storage Comment Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.