anti-Rat (Rattus) STAT5A antibody for Immunocytochemistry

Recommended STAT5A Antibody (supplied by: Log in to see )

Signal Transducer and Activator of Transcription 5A (STAT5A) Antibodies
  • MGF
  • STAT5
  • AA959963
  • Stat5
  • STATA5
  • STAT5A
  • stat5
  • stat5b
  • stat5a
  • signal transducer and activator of transcription 5A
  • signal transducer and activator of transcription 5a
  • signal transducer and activator of transcription 5B
  • signal transducer and activator of transcription 5B L homeolog
  • STAT5A
  • Stat5a
  • stat5a
  • STAT5B
  • LOC100348518
  • LOC100716811
  • stat5b.L
Human, Mouse (Murine), Rat (Rattus)
This STAT5A antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4356401
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1830952 ICC WB Rabbit IgG pTyr694 Log in to see Polyclonal 0
1 ABIN2572844 ICC IF WB Rabbit Internal Region Log in to see Polyclonal 0
1 ABIN4356410 ELISA ICC IF IHC IHC (p) WB DyLight 350 Mouse IgG1 kappa pTyr694 Log in to see 5F6-F1 0
1 ABIN4356411 ELISA ICC IF IHC IHC (p) WB DyLight 488 Mouse IgG1 kappa pTyr694 Log in to see 5F6-F1 0
1 ABIN4356422 ELISA ICC IF IHC IHC (p) WB Alexa Fluor 647 Mouse IgG1 kappa pTyr694 Log in to see 5F6-F1 0
1 ABIN4356399 ELISA ICC IF IHC IHC (p) WB Mouse IgG1 kappa pTyr694 Log in to see 5F6-F1 0
1 ABIN4356412 ELISA ICC IF IHC IHC (p) WB DyLight 405 Mouse IgG1 kappa pTyr694 Log in to see 5F6-F1 0
1 ABIN4356421 ELISA ICC IF IHC IHC (p) WB Alexa Fluor 488 Mouse IgG1 kappa pTyr694 Log in to see 5F6-F1 0
1 ABIN4356420 ELISA ICC IF IHC IHC (p) WB Alexa Fluor 405 Mouse IgG1 kappa pTyr694 Log in to see 5F6-F1 0
1 ABIN4356423 ELISA ICC IF IHC IHC (p) WB Alexa Fluor 700 Mouse IgG1 kappa pTyr694 Log in to see 5F6-F1 0
1 ABIN4356405 ELISA ICC IF IHC IHC (p) WB PerCP Mouse IgG1 kappa pTyr694 Log in to see 5F6-F1 0
1 ABIN4356407 ELISA ICC IF IHC IHC (p) WB DyLight 755 Mouse IgG1 kappa pTyr694 Log in to see 5F6-F1 0
1 ABIN4356409 ELISA ICC IF IHC IHC (p) WB DyLight 680 Mouse IgG1 kappa pTyr694 Log in to see 5F6-F1 0
1 ABIN4356406 ELISA ICC IF IHC IHC (p) WB APC Mouse IgG1 kappa pTyr694 Log in to see 5F6-F1 0
1 ABIN4356402 FACS ICC IF IHC IHC (p) WB Mouse IgG1 Log in to see 9F7 0
1 ABIN4356404 ELISA ICC IF IHC IHC (p) WB PE Mouse IgG1 kappa pTyr694 Log in to see 5F6-F1 0
1 ABIN4356395 ICC IF WB Rabbit Log in to see Polyclonal 0


Antigen Signal Transducer and Activator of Transcription 5A (STAT5A) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(496), (223), (193), (35), (24), (19), (17), (17), (7), (4), (4), (1), (1), (1), (1), (1), (1)
Host Rabbit
(350), (148), (16)
Conjugate This STAT5A antibody is un-conjugated
(13), (12), (11), (9), (8), (8), (8), (5), (4), (4), (4), (4), (4), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(394), (232), (168), (97), (91), (90), (46), (41), (26), (17), (11), (9), (7), (7), (6), (4), (3), (2), (2), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-STAT5A Antibody

Target Details STAT5A Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:YPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS
Isotype IgG

Target Details STAT5A

Product Details anti-STAT5A Antibody Application Details Handling Images back to top
Alternative Name STAT5a (STAT5A Antibody Abstract)
Background Gene Symbol: STAT5A
Gene ID 6776
Pathways JAK-STAT Signaling, RTK Signaling, Response to Growth Hormone Stimulus, C21-Steroid Hormone Metabolic Process, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, CXCR4-mediated Signaling Events, Activated T Cell Proliferation

Application Details

Product Details anti-STAT5A Antibody Target Details STAT5A Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-STAT5A Antibody Target Details STAT5A Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-STAT5A Antibody Target Details STAT5A Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Signal Transducer and Activator of Transcription 5A (STAT5A) antibody (ABIN4356401) Immunocytochemistry/Immunofluorescence: STAT5a Antibody - Immunofluorescent staining...
Western Blotting (WB) image for anti-Signal Transducer and Activator of Transcription 5A (STAT5A) antibody (ABIN4356401) Western Blot: STAT5a Antibody - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibrobl...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Signal Transducer and Activator of Transcription 5A (STAT5A) antibody (ABIN4356401) Immunohistochemistry-Paraffin: STAT5a Antibody - Staining of human lymph node shows ...