anti-Mouse (Murine) STAT6 antibody for Immunofluorescence

Recommended STAT6 Antibody (supplied by: Log in to see )

Antigen
Signal Transducer and Activator of Transcription 6, Interleukin-4 Induced (STAT6) Antibodies
  • D12S1644
  • IL-4-STAT
  • STAT6B
  • STAT6C
  • signal transducer and activator of transcription 6
  • signal transducer and activator of transcription 6-like
  • STAT6
  • Stat6
  • LOC100859543
Reactivity
Human, Mouse (Murine), Rat (Rattus)
420
184
129
24
20
17
15
14
9
6
3
2
2
1
1
Host
Rabbit
277
169
6
1
1
Clonality
Polyclonal
Conjugate
This STAT6 antibody is un-conjugated
16
15
15
14
12
10
10
7
7
5
5
5
5
5
5
5
5
5
5
4
3
3
3
3
3
3
3
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes), Western Blotting (WB)
334
149
132
63
51
41
39
39
34
11
5
4
3
2
2
1
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4356445
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.758385 ABIN1109154 EIA IF WB Mouse IgG1 Log in to see 7D3 3
1 ABIN968456 IF WB Mouse IgG1 C-Term Log in to see 23-Stat6 9
1 ABIN968455 IF WB Mouse IgG1 C-Term Log in to see 23-Stat6 9
1 ABIN153168 ICC IF IHC IHC (p) IP WB Rabbit AA 600-650 Log in to see Polyclonal 2
1 ABIN1501202 ICC IF ELISA WB Mouse IgG1 Log in to see 7D3 0
1 ABIN1938717 IF IP IHC (p) WB Rabbit IgG AA 600-650 Log in to see Polyclonal 0
1 ABIN5681838 ELISA ICC IF WB Mouse IgG1 Log in to see 7D3 0
1 ABIN967099 IF ELISA WB Mouse IgG1 Log in to see 7D3 3
1 ABIN1585750 IF WB Mouse IgG1 Log in to see 7D3 0
1 ABIN4994136 ICC IF IHC IHC (p) WB DyLight 650 Rabbit AA 600-650 Log in to see Polyclonal 0
1 ABIN4994142 ICC IF IHC IHC (p) WB DyLight 550 Rabbit AA 600-650 Log in to see Polyclonal 0
1 ABIN4994139 ICC IF IHC IHC (p) WB DyLight 488 Rabbit AA 600-650 Log in to see Polyclonal 0
1 ABIN4994133 ICC IF IHC IHC (p) WB Alexa Fluor 647 Rabbit AA 600-650 Log in to see Polyclonal 0
1 ABIN4994134 ICC IF IHC IHC (p) WB Alexa Fluor 700 Rabbit AA 600-650 Log in to see Polyclonal 0
1 ABIN4994135 ICC IF IHC IHC (p) WB Biotin Rabbit AA 600-650 Log in to see Polyclonal 0
1 ABIN4994138 ICC IF IHC IHC (p) WB DyLight 680 Rabbit AA 600-650 Log in to see Polyclonal 0
1 ABIN4994137 ICC IF IHC IHC (p) FITC Rabbit AA 600-650 Log in to see Polyclonal 0
1 ABIN4994141 ICC IF IHC IHC (p) WB DyLight 755 Rabbit AA 600-650 Log in to see Polyclonal 0
1 ABIN4994143 ICC IF IHC IHC (p) WB DyLight 350 Rabbit AA 600-650 Log in to see Polyclonal 0
1 ABIN4994144 ICC IF IHC IHC (p) WB DyLight 405 Rabbit AA 600-650 Log in to see Polyclonal 0

General

Antigen Signal Transducer and Activator of Transcription 6, Interleukin-4 Induced (STAT6) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(420), (184), (129), (24), (20), (17), (15), (14), (9), (6), (3), (2), (2), (1), (1)
Host Rabbit
(277), (169), (6), (1), (1)
Clonality
Polyclonal
Conjugate This STAT6 antibody is un-conjugated
(16), (15), (15), (14), (12), (10), (10), (7), (7), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5), (4), (3), (3), (3), (3), (3), (3), (3), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes), Western Blotting (WB)
(334), (149), (132), (63), (51), (41), (39), (39), (34), (11), (5), (4), (3), (2), (2), (1), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-STAT6 Antibody

Target Details STAT6 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLR
Isotype IgG

Target Details STAT6

Product Details anti-STAT6 Antibody Application Details Handling Images back to top
Antigen
Alternative Name STAT6 (STAT6 Antibody Abstract)
Background Gene Symbol: STAT6
Gene ID 6778
Pathways JAK-STAT Signaling, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response

Application Details

Product Details anti-STAT6 Antibody Target Details STAT6 Handling Images back to top
Application Notes Western Blot 1:100-1:500, Simple Western 1:20, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100. In Simple Western only 10 - 15 μL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-STAT6 Antibody Target Details STAT6 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-STAT6 Antibody Target Details STAT6 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Signal Transducer and Activator of Transcription 6, Interleukin-4 Induced (STAT6) antibody (ABIN4356445) Western Blot: STAT6 Antibody - Analysis in mouse cell line NIH-3T3, rat cell line NB...
Western Blotting (WB) image for anti-Signal Transducer and Activator of Transcription 6, Interleukin-4 Induced (STAT6) antibody (ABIN4356445) Western Blot: STAT6 Antibody - Analysis in human cell line Daudi.
Western Blotting (WB) image for anti-Signal Transducer and Activator of Transcription 6, Interleukin-4 Induced (STAT6) antibody (ABIN4356445) Western Blot: STAT6 Antibody - Analysis in human cell lines A-549 and U-251MG using ...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Signal Transducer and Activator of Transcription 6, Interleukin-4 Induced (STAT6) antibody (ABIN4356445) Immunohistochemistry-Paraffin: STAT6 Antibody - Staining of human urinary bladder sh...
Immunofluorescence (IF) image for anti-Signal Transducer and Activator of Transcription 6, Interleukin-4 Induced (STAT6) antibody (ABIN4356445) Immunocytochemistry/Immunofluorescence: STAT6 Antibody - Staining of human cell line...