anti-Fruit Fly (Drosophila melanogaster) Dynein, Light Chain, LC8-Type 1 antibody for Western Blotting

Recommended Dynein, Light Chain, LC8-Type 1 Antibody (supplied by: Log in to see )

Antigen
Dynein, Light Chain, LC8-Type 1 (DYNLL1) Antibodies
  • DLC1
  • DLC8
  • DNCL1
  • DNCLC1
  • LC8
  • LC8a
  • PIN
  • hdlc1
  • dynll2
  • wu:fd56c09
  • zgc:73406
  • Dlc8
  • Dnclc1
  • Pin
  • 8kDLC
  • lc8
  • dlc1
  • dlc8
  • lc8a
  • dncl1
  • dnclc1
  • dynll1a
  • MGC68763
  • CDLC2
  • dynll1
  • dynll1b
  • pin
  • MGC89636
  • dynein light chain LC8-type 1
  • dynein, light chain, LC8-type 1
  • dynein light chain LC8-type 1 S homeolog
  • dynein light chain LC8-type 1 L homeolog
  • Dynein light chain 1, cytoplasmic
  • DYNLL1
  • dynll1
  • Dynll1
  • dynll1.S
  • dynll1.L
  • dlc-1
Epitope
N-Term
7
5
3
2
1
1
1
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus), Fruit Fly (Drosophila melanogaster)
63
22
20
7
7
7
7
7
6
4
4
4
4
3
3
3
3
1
Host
Rabbit
38
21
4
Clonality
Polyclonal
Conjugate
Un-conjugated
4
4
3
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
57
22
19
6
6
5
5
2
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Catalog No. ABIN631146
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
7 ABIN768961 IHC IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal 0
7 ABIN768963 IHC IHC (p) WB Rabbit N-Term Log in to see Polyclonal 0
4 ABIN321948 WB Rabbit IgG N-Term Log in to see Polyclonal 0

General

Antigen Dynein, Light Chain, LC8-Type 1 (DYNLL1) Antibodies
Epitope N-Term
(7), (5), (3), (2), (1), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus), Fruit Fly (Drosophila melanogaster)
(63), (22), (20), (7), (7), (7), (7), (7), (6), (4), (4), (4), (4), (3), (3), (3), (3), (1)
Host Rabbit
(38), (21), (4)
Clonality
Polyclonal
Conjugate Un-conjugated
(4), (4), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(57), (22), (19), (6), (6), (5), (5), (2), (2), (1)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Specificity DYNLL1 antibody was raised against the N terminal of DYNLL1
Purification Affinity purified
Immunogen DYNLL1 antibody was raised using the N terminal of DYNLL1 corresponding to a region with amino acids MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKY

Target Details

Product details Application Details Handling Images back to top
Antigen
Alternative Name DYNLL1 (DYNLL1 Antibody Abstract)
Background Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kDa. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. DYNLL1 is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity.
Molecular Weight 10 kDa (MW of target protein)
Pathways M Phase, Tube Formation, Positive Regulation of Endopeptidase Activity

Application Details

Product details Target Details Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

DYNLL1 Blocking Peptide, catalog no. 33R-5809, is also available for use as a blocking control in assays to test for specificity of this DYNLL1 antibody

Restrictions For Research Use only

Handling

Product details Target Details Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYNLL1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.