anti-Human Ninein (GSK3B Interacting Protein) antibody for Immunofluorescence

Recommended Ninein (GSK3B Interacting Protein) Antibody (supplied by: Log in to see )

Antigen
Ninein (GSK3B Interacting Protein) (NIN) Antibodies
  • si:ch211-282c13.6
  • ninein
  • 3110068G20Rik
  • AI385615
  • AU024711
  • mKIAA1565
  • SCKL7
  • ninein
  • ninein (GSK3B interacting protein)
  • ninein L homeolog
  • NIN
  • nin
  • nin.L
  • lpg0126
  • LPC_0146
  • lpa_00185
  • Nin
Reactivity
Human
18
11
8
Host
Rabbit
25
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
19
13
4
4
3
3
2
Options
Supplier
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN4339743
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
-3.6835604 ABIN5078373 ICC IF Rabbit IgG Log in to see Polyclonal 0

General

Antigen Ninein (GSK3B Interacting Protein) (NIN) Antibodies
Reactivity Human
(18), (11), (8)
Host Rabbit
(25)
Clonality
Polyclonal
Conjugate Un-conjugated
(1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(19), (13), (4), (4), (3), (3), (2)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: EERLTQMRNEYERQCRVLQDQVDELQSELEEYRAQGRVLRLPLKNSPSEE VEANSGGIEPEHGLGSEECNPLNMSIEAELVIEQMKEQHHRDICCLRLEL EDKVRHYEKQLDETVVSCKKAQENMKQRHENETHTL
Isotype IgG

Target Details

Product details Application Details Handling Images back to top
Antigen
Alternative Name Ninein (NIN Antibody Abstract)
Background Gene Symbol: NIN
Gene ID 51199
Pathways Maintenance of Protein Location

Application Details

Product details Target Details Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product details Target Details Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product details Target Details Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Ninein (GSK3B Interacting Protein) (NIN) antibody (ABIN4339743) Immunocytochemistry/Immunofluorescence: Ninein Antibody [NBP2-13657] - Staining of hu...
Immunohistochemistry (IHC) image for anti-Ninein (GSK3B Interacting Protein) (NIN) antibody (ABIN4339743) Immunohistochemistry: Ninein Antibody [NBP2-13657] - Staining of human appendix shows...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ninein (GSK3B Interacting Protein) (NIN) antibody (ABIN4339743) Immunohistochemistry-Paraffin: Ninein Antibody - Staining of human pancreas shows lo...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ninein (GSK3B Interacting Protein) (NIN) antibody (ABIN4339743) Immunohistochemistry-Paraffin: Ninein Antibody - Staining of human appendix shows hi...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ninein (GSK3B Interacting Protein) (NIN) antibody (ABIN4339743) Immunohistochemistry-Paraffin: Ninein Antibody - Staining in human appendix and panc...