anti-Human BTG2 antibody for Immunofluorescence

Recommended BTG2 Antibody (supplied by: Log in to see )

Antigen
BTG Family, Member 2 (BTG2) Antibodies
  • PC3
  • TIS21
  • XBtg2
  • BTG2
  • AA959598
  • APRO1
  • Pc3
  • Agl
  • An
  • Tis21
  • an-1
  • BTG family member 2
  • BTG anti-proliferation factor 2
  • B cell translocation gene 2, anti-proliferative
  • btg2
  • BTG2
  • Btg2
Reactivity
Human
71
22
22
4
2
2
2
2
2
1
1
1
Host
Rabbit
54
17
Clonality
Polyclonal
Conjugate
This BTG2 antibody is un-conjugated
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
55
30
25
13
9
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4285521
Contact our Customer Service for availability and price in your country.

General

Antigen BTG Family, Member 2 (BTG2) Antibodies
Reactivity Human
(71), (22), (22), (4), (2), (2), (2), (2), (2), (1), (1), (1)
Host Rabbit
(54), (17)
Clonality
Polyclonal
Conjugate This BTG2 antibody is un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(55), (30), (25), (13), (9), (1)
Supplier Log in to see

Product Details anti-BTG2 Antibody

Target Details BTG2 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLG
Isotype IgG
Plasmids, Primers & others

Target Details BTG2

Product Details anti-BTG2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name BTG2 (BTG2 Antibody Abstract)
Background Gene Symbol: BTG2
Gene ID 7832
Pathways MAPK Signaling

Application Details

Product Details anti-BTG2 Antibody Target Details BTG2 Handling Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-BTG2 Antibody Target Details BTG2 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-BTG2 Antibody Target Details BTG2 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-BTG Family, Member 2 (BTG2) antibody (ABIN4285521) Western Blot: BTG2 Antibody [NBP1-81215] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunofluorescence (IF) image for anti-BTG Family, Member 2 (BTG2) antibody (ABIN4285521) Immunocytochemistry/Immunofluorescence: BTG2 Antibody [NBP1-81215] - Staining of huma...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-BTG Family, Member 2 (BTG2) antibody (ABIN4285521) Immunohistochemistry-Paraffin: BTG2 Antibody [NBP1-81215] - Staining of human cerebel...
Immunofluorescence (IF) image for anti-BTG Family, Member 2 (BTG2) antibody (ABIN4285521) Immunocytochemistry/Immunofluorescence: BTG2 Antibody - Immunofluorescent staining o...