anti-Rat (Rattus) MAP2K1 antibody for Immunocytochemistry

Recommended MAP2K1 Antibody (supplied by: Log in to see )

Antigen
Mitogen-Activated Protein Kinase Kinase 1 (MAP2K1) Antibodies
  • Mek1
  • CFC3
  • MAPKK1
  • MEK1
  • MKK1
  • PRKMK1
  • MEKK1
  • Prkmk1
  • mek-2
  • si:ch211-242m18.2
  • wu:fj56a12
  • wu:fj61b01
  • zgc:56557
  • ATMEK1
  • F20B18.180
  • F20B18_180
  • MAP kinase/ ERK kinase 1
  • MITOGEN ACTIVATED PROTEIN KINASE KINASE
  • MITOGEN ACTIVATED PROTEIN KINASE KINASE 1
  • NMAPKK
  • MEK
  • mitogen activated protein kinase kinase 1
  • mitogen-activated protein kinase kinase 1
  • mitogen-activated protein kinase kinase 1 L homeolog
  • MAP kinase/ ERK kinase 1
  • Map2k1
  • MAP2K1
  • map2k1.L
  • map2k1
  • MEK1
Reactivity
Human, Rat (Rattus)
657
422
370
108
80
45
30
26
22
21
10
8
5
5
4
4
4
2
1
1
Host
Rabbit
531
128
5
3
2
1
Clonality
Polyclonal
Conjugate
This MAP2K1 antibody is un-conjugated
17
16
16
12
9
9
9
8
6
6
6
6
6
6
6
6
6
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
521
199
161
132
121
78
27
22
18
10
9
7
6
6
3
2
2
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4333486
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN3044391 ICC IHC (p) WB Rabbit IgG AA 353-367, C-Term Log in to see Polyclonal 0
1 ABIN4333491 ICC IF IHC IHC (p) WB Rabbit IgG Center Log in to see Polyclonal 0
1 ABIN1493436 ICC IHC (p) IP WB Sepharose Rabbit AA 353-367 Log in to see Polyclonal 0
1 ABIN1493435 ICC IHC (p) IP WB Magnetic Particles Rabbit AA 353-367 Log in to see Polyclonal 0
1 ABIN1493434 ICC IHC (p) WB Rabbit AA 353-367 Log in to see Polyclonal 0
1 ABIN4333482 ICC IF IHC IHC (p) WB Rabbit pThr292 Log in to see Polyclonal 0
1 ABIN3031839 ICC IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN1825708 ICC WB Rabbit Log in to see Polyclonal 0
1 ABIN966512 ICC IHC (p) WB C-Term, AA 353-367 Log in to see Polyclonal 2

General

Antigen Mitogen-Activated Protein Kinase Kinase 1 (MAP2K1) Antibodies
Reactivity Human, Rat (Rattus)
(657), (422), (370), (108), (80), (45), (30), (26), (22), (21), (10), (8), (5), (5), (4), (4), (4), (2), (1), (1)
Host Rabbit
(531), (128), (5), (3), (2), (1)
Clonality
Polyclonal
Conjugate This MAP2K1 antibody is un-conjugated
(17), (16), (16), (12), (9), (9), (9), (8), (6), (6), (6), (6), (6), (6), (6), (6), (6), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(521), (199), (161), (132), (121), (78), (27), (22), (18), (10), (9), (7), (6), (6), (3), (2), (2), (1), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-MAP2K1 Antibody

Target Details MAP2K1 Application Details Handling References for anti-MAP2K1 antibody (ABIN4333486) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQ
Isotype IgG

Target Details MAP2K1

Product Details anti-MAP2K1 Antibody Application Details Handling References for anti-MAP2K1 antibody (ABIN4333486) Images back to top
Antigen
Alternative Name MEK1 (MAP2K1 Antibody Abstract)
Background Gene Symbol: MAP2K1
Gene ID 5604
Pathways MAPK Signaling, RTK Signaling, Interferon-gamma Pathway, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Activation of Innate immune Response, Toll-Like Receptors Cascades, Autophagy, Signaling of Hepatocyte Growth Factor Receptor

Application Details

Product Details anti-MAP2K1 Antibody Target Details MAP2K1 Handling References for anti-MAP2K1 antibody (ABIN4333486) Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-MAP2K1 Antibody Target Details MAP2K1 Application Details References for anti-MAP2K1 antibody (ABIN4333486) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-MAP2K1 antibody (ABIN4333486)

Product Details anti-MAP2K1 Antibody Target Details MAP2K1 Application Details Handling Images back to top
Product cited in:

Pénzváltó, Lánczky, Lénárt, Meggyesházi, Krenács, Szoboszlai, Denkert, Pete, Győrffy: "MEK1 is associated with carboplatin resistance and is a prognostic biomarker in epithelial ovarian cancer." in: BMC cancer, Vol. 14, pp. 837, 2014 (Sample species: Human). Further details: Immunohistochemistry

Images

Product Details anti-MAP2K1 Antibody Target Details MAP2K1 Application Details Handling References for anti-MAP2K1 antibody (ABIN4333486) back to top
Supplier Images
Western Blotting (WB) image for anti-Mitogen-Activated Protein Kinase Kinase 1 (MAP2K1) antibody (ABIN4333486) Western Blot: MEK1 Antibody [NBP1-87790] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...
Western Blotting (WB) image for anti-Mitogen-Activated Protein Kinase Kinase 1 (MAP2K1) antibody (ABIN4333486) Western Blot: MEK1 Antibody [NBP1-87790] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Immunofluorescence (IF) image for anti-Mitogen-Activated Protein Kinase Kinase 1 (MAP2K1) antibody (ABIN4333486) Immunocytochemistry/Immunofluorescence: MEK1 Antibody [NBP1-87790] - Staining of huma...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Mitogen-Activated Protein Kinase Kinase 1 (MAP2K1) antibody (ABIN4333486) Immunohistochemistry-Paraffin: MEK1 Antibody [NBP1-87790] - Staining of human hippoca...