anti-Rat (Rattus) MAP2K3 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended MAP2K3 Antibody (supplied by: Log in to see )

Antigen
Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3) Antibodies
  • MAPKK3
  • MEK3
  • MKK3
  • PRKMK3
  • SAPKK-2
  • SAPKK2
  • AW212142
  • Prkmk3
  • mMKK3b
  • Mkk3
  • mitogen-activated protein kinase kinase 3
  • mitogen activated protein kinase kinase 3
  • MAP kinase activator XMEK3
  • MAP2K3
  • Map2k3
  • map2k3
Epitope
AA 311-347, C-Term
40
28
18
13
12
11
11
10
10
7
7
6
5
5
4
4
3
3
3
3
3
2
2
2
2
1
1
1
1
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
317
168
153
56
39
6
5
5
4
3
1
1
1
1
Host
Rabbit
229
87
Clonality
Polyclonal
Conjugate
This MAP2K3 antibody is un-conjugated
7
7
6
3
3
2
2
2
2
2
2
2
2
2
2
2
2
2
2
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
274
128
99
86
65
26
17
12
10
7
3
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN3043874
$ 280.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
17.311565 ABIN966513 ICC IHC (p) WB C-Term, AA 320-334 Log in to see Polyclonal 1
16 ABIN1499400 IF IHC IHC (p) WB Mouse IgG1 Log in to see 5F2 0
16 ABIN1499404 IF IHC IHC (p) WB Mouse IgG2b Log in to see 6F8 0
16 ABIN1499402 IF IHC IHC (p) WB Mouse IgG2b Log in to see 5F9 0
14.5 ABIN3044392 IHC (p) WB Rabbit IgG AA 320-334, C-Term Log in to see Polyclonal 1
13 ABIN1499398 IF IHC IHC (p) WB Mouse IgG2a Log in to see 1B5 0
13 ABIN1499399 IF IHC IHC (p) WB Mouse IgG2b Log in to see 6B12 0
11.7556305 ABIN2177687 IF (p) IHC (p) WB Rabbit IgG pSer207 Log in to see Polyclonal 0
10 ABIN6652193 IF IHC (p) WB Rabbit pSer189 Log in to see Polyclonal 2
10 ABIN6652589 IF IHC (p) WB Rabbit Ser189 Log in to see Polyclonal 2
9.9974375 ABIN5950423 FACS ICC IF IHC IHC (p) IP WB Rabbit IgG C-Term Log in to see JJ087-09 0
7 ABIN2878962 ELISA IHC IHC (p) WB Rabbit IgG AA 173-222 Log in to see Polyclonal 0
7 ABIN1736710 IHC (p) ELISA WB Rabbit IgG Internal Region Log in to see Polyclonal 0
7 ABIN3031841 IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal 0
6.9974375 ABIN5950424 FACS ICC IF IHC IHC (p) IP WB Rabbit IgG C-Term Log in to see SD20-93 0
4 ABIN5959691 ELISA IHC (p) WB Rabbit IgG pSer218 Log in to see Polyclonal 0
2.241807 ABIN257414 ICC IF IHC (p) IHC WB Rabbit pSer189 Log in to see Polyclonal 0
1 ABIN2177698 IHC (p) WB HRP Rabbit IgG pSer207 Log in to see Polyclonal 0
1 ABIN754177 IHC (p) WB HRP Rabbit IgG pThr222 Log in to see Polyclonal 0
1 ABIN2625064 IF IHC IHC (p) WB Mouse IgG2b Log in to see 2A7 0

General

Antigen Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3) Antibodies
Epitope AA 311-347, C-Term
(40), (28), (18), (13), (12), (11), (11), (10), (10), (7), (7), (6), (5), (5), (4), (4), (3), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(317), (168), (153), (56), (39), (6), (5), (5), (4), (3), (1), (1), (1), (1)
Host Rabbit
(229), (87)
Clonality
Polyclonal
Conjugate This MAP2K3 antibody is un-conjugated
(7), (7), (6), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(274), (128), (99), (86), (65), (26), (17), (12), (10), (7), (3), (1), (1), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-MAP2K3 Antibody

Target Details MAP2K3 Application Details Handling References for anti-MAP2K3 antibody (ABIN3043874) Images
Purpose Rabbit IgG polyclonal antibody for Dual specificity mitogen-activated protein kinase kinase 3(MAP kinase kinase 3/MAPKK 3)(MAP2K3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Sequence AERMSYLELM EHPFFTLHKT KKTDIAAFVK EILGEDS
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Dual specificity mitogen-activated protein kinase kinase 3(MAP kinase kinase 3/MAPKK 3)(MAP2K3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: mitogen-activated protein kinase kinase 3
Protein Name: Dual specificity mitogen-activated protein kinase kinase 3(MAP kinase kinase 3/MAPKK 3)
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human MEK3 (311-347aa AERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS), identical to the related mouse sequence.
Isotype IgG
Plasmids, Primers & others

Target Details MAP2K3

Product Details anti-MAP2K3 Antibody Application Details Handling References for anti-MAP2K3 antibody (ABIN3043874) Images back to top
Antigen
Alternative Name MAP2K3 (MAP2K3 Antibody Abstract)
Background Dual specificity mitogen-activated protein kinase kinase 3 is an enzyme that in humans is encoded by the MAP2K3 gene. The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. And this kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. Rampoldi et al. (1997) localized the MAP2K3 gene to 17q11.2.

Synonyms: AW212142 antibody|Dual specificity mitogen activated protein kinase kinase 3 antibody|Dual specificity mitogen-activated protein kinase kinase 3 antibody|ERK kinase 3 antibody|MAP kinase kinase 3 antibody|MAP2K 3 antibody|map2k3 antibody|MAPK ERK kinase 3 antibody|MAPK kinase 3 antibody|MAPK/ERK kinase 3 antibody|MAPKK 3 antibody|MAPKK3 antibody|MEK 3 antibody|MEK3 antibody|Mitogen activated protein kinase kinase 3 antibody|MKK 3 antibody|MKK3 antibody| mMKK 3b antibody| mMKK3b antibody|MP2K3_HUMAN antibody|MPK 3 antibody|PRKMK 3 antibody|PRKMK3 antibody|Protein kinase mitogen activated kinase 3 antibody|protein kinase, mitogen-activated, kinase 3 antibody|SAPK kinase 2 antibody|SAPKK 2 antibody|SAPKK2 antibody|SKK2 antibody|Stress activated protein kinase kinase 2 antibody| zMKK 3 antibody
Gene ID 5606
UniProt P46734
Pathways MAPK Signaling, TLR Signaling, Activation of Innate immune Response, Toll-Like Receptors Cascades, Autophagy, Signaling Events mediated by VEGFR1 and VEGFR2

Application Details

Product Details anti-MAP2K3 Antibody Target Details MAP2K3 Handling References for anti-MAP2K3 antibody (ABIN3043874) Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Comment

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions For Research Use only

Handling

Product Details anti-MAP2K3 Antibody Target Details MAP2K3 Application Details References for anti-MAP2K3 antibody (ABIN3043874) Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-MAP2K3 antibody (ABIN3043874)

Product Details anti-MAP2K3 Antibody Target Details MAP2K3 Application Details Handling Images back to top
Product cited in:

Cheng, Wang, Wang, Wang, Du, Lou: "Silencing Ras-Related C3 Botulinum Toxin Substrate 1 Inhibits Growth and Migration of Hypopharyngeal Squamous Cell Carcinoma via the P38 Mitogen-Activated Protein Kinase Signaling Pathway." in: Medical science monitor : international medical journal of experimental and clinical research, Vol. 24, pp. 768-781, 2018

Xu, Zhang, Wei, Jia, Ge, Zhang, Liu: "MicroRNA-21 promotes hepatocellular carcinoma HepG2 cell proliferation through repression of mitogen-activated protein kinase-kinase 3." in: BMC cancer, Vol. 13, pp. 469, 2013

Images

Product Details anti-MAP2K3 Antibody Target Details MAP2K3 Application Details Handling References for anti-MAP2K3 antibody (ABIN3043874) back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3) (AA 311-347), (C-Term) antibody (ABIN3043874) Anti- MEK3 Picoband antibody, IHC(P) IHC(P): Mouse Skeletal Muscle Tissue
Western Blotting (WB) image for anti-Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3) (AA 311-347), (C-Term) antibody (ABIN3043874) anti-Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3) (AA 311-347), (C-Term) antibody (Image 2)
Immunohistochemistry (IHC) image for anti-Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3) (AA 311-347), (C-Term) antibody (ABIN3043874) Anti- MEK3 Picoband antibody, IHC(P) IHC(P): Rat Skeletal Muscle Tissue
Immunohistochemistry (IHC) image for anti-Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3) (AA 311-347), (C-Term) antibody (ABIN3043874) Anti- MEK3 Picoband antibody, IHC(P) IHC(P): Human Intestinal Cancer Tissue