anti-Human MAP3K3 antibody for Immunocytochemistry

Recommended MAP3K3 Antibody (supplied by: Log in to see )

Mitogen-Activated Protein Kinase Kinase Kinase 3 (MAP3K3) Antibodies
  • MEKK3
  • AW548911
  • Mekk3
  • mKIAA4031
  • mitogen activated protein kinase kinase kinase 3
  • mitogen-activated protein kinase kinase kinase 3
  • Map3k3
  • MAP3K3
  • map3k3
This MAP3K3 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5078046
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN2587022 ICC IF IHC (p) WB Rabbit Internal Region Log in to see Polyclonal 0
1 ABIN5620145 ICC IF IHC WB Rabbit Center Log in to see Polyclonal 0


Antigen Mitogen-Activated Protein Kinase Kinase Kinase 3 (MAP3K3) Antibodies
Reactivity Human
(42), (38), (10), (2), (1), (1), (1), (1), (1), (1), (1)
Host Rabbit
(53), (9)
Conjugate This MAP3K3 antibody is un-conjugated
(2), (2), (2), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(61), (22), (11), (11), (8), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-MAP3K3 Antibody

Target Details MAP3K3 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNHNSSSPHSGVSRQVRIKASQSAGDINTIYQPPEPRSRHLSVSSQ
Isotype IgG

Target Details MAP3K3

Product Details anti-MAP3K3 Antibody Application Details Handling Images back to top
Alternative Name MEKK3 (MAP3K3 Antibody Abstract)
Background Gene Symbol: MAP3K3
Gene ID 4215
Pathways MAPK Signaling

Application Details

Product Details anti-MAP3K3 Antibody Target Details MAP3K3 Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-MAP3K3 Antibody Target Details MAP3K3 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-MAP3K3 Antibody Target Details MAP3K3 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Mitogen-Activated Protein Kinase Kinase Kinase 3 (MAP3K3) antibody (ABIN5078046) Immunocytochemistry/Immunofluorescence: MEKK3 Antibody - Staining of human cell line...