anti-Hamster MAPK3 antibody for Functional Studies

Recommended MAPK3 Antibody (supplied by: Log in to see )

Antigen
Mitogen-Activated Protein Kinase 3 (MAPK3) Antibodies
  • ERK-1
  • ERK1
  • ERT2
  • HS44KDAP
  • HUMKER1A
  • P44ERK1
  • P44MAPK
  • PRKM3
  • p44-ERK1
  • p44-MAPK
  • Erk-1
  • Erk1
  • Ert2
  • Esrk1
  • Mnk1
  • Mtap2k
  • Prkm3
  • p44
  • p44erk1
  • p44mapk
  • fi06b09
  • wu:fi06b09
  • zERK1
  • Tb08.10J17.940
  • MAPK1
  • MNK1
  • ATMAPK3
  • ATMPK3
  • T6D9.4
  • mitogen-activated protein kinase 3
  • mitogen-activated protein kinase 3
  • mitogen activated protein kinase 3
  • mitogen-activated serine/threonine-protein kinase
  • MAPK3
  • Mapk3
  • mapk3
  • Tc00.1047053509475.10
  • Tb927.8.3550
  • CEK1
  • MPK3
Epitope
AA 372-406
65
55
39
39
25
20
18
16
15
14
14
11
11
10
8
7
5
5
4
4
4
4
3
3
3
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Hamster, Mouse (Murine), Rabbit, Rat (Rattus)
569
335
271
53
42
38
38
24
24
23
20
13
12
11
10
9
6
4
3
2
2
2
1
1
1
1
Host
Rabbit
403
168
21
6
1
Clonality
Polyclonal
Conjugate
This MAPK3 antibody is un-conjugated
29
27
25
17
16
13
6
6
6
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
2
2
2
2
1
1
Application
Functional Studies (Func), Immunoprecipitation (IP), Western Blotting (WB)
493
215
203
112
89
70
58
57
39
35
15
13
8
4
3
2
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Catalog No. ABIN199418
$ 925.83
Plus shipping costs $45.00

General

Antigen Mitogen-Activated Protein Kinase 3 (MAPK3) Antibodies
Epitope AA 372-406
(65), (55), (39), (39), (25), (20), (18), (16), (15), (14), (14), (11), (11), (10), (8), (7), (5), (5), (4), (4), (4), (4), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Hamster, Mouse (Murine), Rabbit, Rat (Rattus)
(569), (335), (271), (53), (42), (38), (38), (24), (24), (23), (20), (13), (12), (11), (10), (9), (6), (4), (3), (2), (2), (2), (1), (1), (1), (1)
Host Rabbit
(403), (168), (21), (6), (1)
Clonality
Polyclonal
Conjugate This MAPK3 antibody is un-conjugated
(29), (27), (25), (17), (16), (13), (6), (6), (6), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1)
Application Functional Studies (Func), Immunoprecipitation (IP), Western Blotting (WB)
(493), (215), (203), (112), (89), (70), (58), (57), (39), (35), (15), (13), (8), (4), (3), (2), (2), (2), (1)
Supplier Log in to see

Product Details anti-MAPK3 Antibody

Target Details MAPK3 Application Details Handling Images
Specificity Recognizes rat MAPK1/Erk1 at 44kD and MAPK2/Erk2 at 42kD. Species cross-reactivity: Human, mouse, chicken and starfish. Species sequence Homology: Chinese hamster: 35/35, mouse: 34/35, human: 32/35.
Predicted Reactivity Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%) Monkey, Bovine, Dog, Bat, Horse, Platypus (97%) Human, Gorilla, Gibbon, Elephant (94%) Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%) Xenopus (84%).
Purification Immunoaffinity purified
Immunogen Synthetic peptide (CGG-PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-terminal 35 amino acids of rat 44kD MAP Kinase 2/ Erk2 (KLH coupled). Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%), Monkey, Bovine, Dog, Bat, Horse, Platypus (97%), Human, Gorilla, Gibbon, Elephant (94%), Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%), Xenopus (84%).

Type of Immunogen: Synthetic peptide - KLH conjugated
Isotype IgG
Plasmids, Primers & others

Target Details MAPK3

Product Details anti-MAPK3 Antibody Application Details Handling Images back to top
Antigen
Alternative Name MAPK3 / ERK1 (MAPK3 Antibody Abstract)
Background Name/Gene ID: MAPK3
Subfamily: MAPK
Family: Protein Kinase

Synonyms: MAPK3, ERK-1, ERT2, HUMKER1A, HS44KDAP, MAP kinase 1, MAP kinase isoform p44, MAPK 1, MAPK 3, p44, p44MAPK, p44-MAPK, p44ERK1, Insulin-stimulated MAP2 kinase, MAP kinase 3, p44-ERK1, ERK1, PRKM3
Gene ID 5595
UniProt P27361
Pathways MAPK Signaling, RTK Signaling, Interferon-gamma Pathway, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals

Application Details

Product Details anti-MAPK3 Antibody Target Details MAPK3 Handling Images back to top
Application Notes Approved: Func, IP, WB (0.1 - 2 μg/mL)

Usage: Suitable for use in Western Blot and Immunoprecipitation. Western Blot: 0.1-2 μg/mL detects MAP kinases in RIPA lysates of mouse 3T3/A31 fibroblasts and L6 cells. 3T3/A31 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-MAP Kinase 1/2 (0.1 μg/mL). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system. Immunoprecipitation Kinase Assay: 4 μg immunoprecipitates active MAP kinases from a lysate of NGF-stimulated (50 ng/mL) PC-12 cells, as demonstrated using the MAPK Immunoprecipitation Kinase Cascade Kit.
Comment

Target Species of Antibody: Rat

Restrictions For Research Use only

Handling

Product Details anti-MAPK3 Antibody Target Details MAPK3 Application Details Images back to top
Format Liquid
Concentration Lot specific
Buffer 0.2 M Tris-glycine,  pH 7.4, 0.15 M sodium chloride, 0.05 % sodium azide, 0.1 mM EDTA.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeat freeze-thaw cycles.
Storage 4 °C,-20 °C
Storage Comment Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.