anti-Rabbit MAPK3 antibody for Immunohistochemistry

Recommended MAPK3 Antibody (supplied by: Log in to see )

Mitogen-Activated Protein Kinase 3 (MAPK3) Antibodies
  • ERK-1
  • ERK1
  • ERT2
  • HS44KDAP
  • P44ERK1
  • P44MAPK
  • PRKM3
  • p44-ERK1
  • p44-MAPK
  • Erk-1
  • Erk1
  • Ert2
  • Esrk1
  • Mnk1
  • Mtap2k
  • Prkm3
  • p44
  • p44erk1
  • p44mapk
  • fi06b09
  • wu:fi06b09
  • zERK1
  • Tb08.10J17.940
  • erk6
  • etID309866.18
  • mapk12
  • sapk3
  • wu:fa05c12
  • zgc:101695
  • MAPK1
  • MNK1
  • ATMPK3
  • T6D9.4
  • mitogen-activated protein kinase 3
  • mitogen-activated protein kinase 3
  • mitogen-activated protein kinase 12a
  • mitogen activated protein kinase 3
  • mitogen-activated serine/threonine-protein kinase
  • MAPK3
  • Mapk3
  • mapk3
  • Tc00.1047053509475.10
  • Tb927.8.3550
  • mapk12a
  • CEK1
  • MPK3
AA 336-367
Hamster, Mouse (Murine), Rabbit, Rat (Rattus)
This MAPK3 antibody is un-conjugated
Immunoprecipitation (IP), Immunohistochemistry (IHC), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Catalog No. ABIN351563
$ 581.17
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN966747 IHC Log in to see Polyclonal 0


Antigen Mitogen-Activated Protein Kinase 3 (MAPK3) Antibodies
Epitope AA 336-367
(66), (55), (39), (36), (24), (20), (18), (16), (15), (15), (14), (11), (10), (9), (8), (7), (5), (5), (4), (4), (4), (4), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Hamster, Mouse (Murine), Rabbit, Rat (Rattus)
(555), (325), (263), (53), (42), (38), (38), (24), (22), (22), (20), (13), (12), (11), (10), (9), (6), (4), (3), (2), (2), (2), (1), (1), (1), (1)
Host Rabbit
(393), (163), (21), (6), (1)
Conjugate This MAPK3 antibody is un-conjugated
(29), (27), (25), (17), (16), (13), (6), (6), (6), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1)
Application Immunoprecipitation (IP), Immunohistochemistry (IHC), Western Blotting (WB)
(484), (209), (204), (103), (84), (70), (58), (52), (39), (35), (15), (13), (8), (4), (3), (2), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-MAPK3 Antibody

Target Details MAPK3 Application Details Handling Images
Specificity This immunoaffinity purified antibody detects ~42kD and ~44kD bands corresponding to Erk1 and Erk2, respectively. The antibody recognizes Erk1 and Erk2 in samples from human, mouse, rat, bovine, chicken, Drosophila, sheep, Xenopus and mussel. Antibody specificity is confirmed by peptide competition studies.
Predicted Reactivity Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%) Monkey, Bovine, Dog, Bat, Horse, Platypus (97%) Human, Gorilla, Gibbon, Elephant (94%) Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%) Xenopus (84%).
Purification Protein A purified
Immunogen A 35 residue synthetic peptide, corresponding to a.a. 333-367 {(CGG)PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP}, of rat Erk1 MAP kinase with the CGG spacer group added and the peptide coupled to KLH. Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%), Monkey, Bovine, Dog, Bat, Horse, Platypus (97%), Human, Gorilla, Gibbon, Elephant (94%), Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%), Xenopus (84%).

Type of Immunogen: Synthetic peptide - KLH conjugated
Plasmids, Primers & others

Target Details MAPK3

Product Details anti-MAPK3 Antibody Application Details Handling Images back to top
Alternative Name MAPK3 / ERK1 (MAPK3 Antibody Abstract)
Background Name/Gene ID: MAPK3
Subfamily: MAPK
Family: Protein Kinase

Synonyms: MAPK3, ERK-1, ERT2, HUMKER1A, HS44KDAP, MAP kinase 1, MAP kinase isoform p44, MAPK 1, MAPK 3, p44, p44MAPK, p44-MAPK, p44ERK1, Insulin-stimulated MAP2 kinase, MAP kinase 3, p44-ERK1, ERK1, PRKM3
Gene ID 5595
UniProt P27361
Pathways MAPK Signaling, RTK Signaling, Interferon-gamma Pathway, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals

Application Details

Product Details anti-MAPK3 Antibody Target Details MAPK3 Handling Images back to top
Application Notes Approved: IHC (10 μg/mL), IP (12.5 μg/mL), WB

Usage: Western Blot (Colorimetric): 1 μg/mL 1 μg/mL. Western Blot (ECL). Immunoprecipitation: 12.5 μg/mL. Immunohistochemistry: 10 μg/mL. Positive control: Mouse Brain Tissue Extract.

Target Species of Antibody: Rat

Restrictions For Research Use only


Product Details anti-MAPK3 Antibody Target Details MAPK3 Application Details Images back to top
Format Liquid
Concentration Lot specific
Buffer Liquid
Handling Advice Avoid repeat freeze-thaw cycles.
Storage 4 °C,-20 °C
Storage Comment Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.