anti-Rabbit MAPK3 antibody for Immunohistochemistry

Recommended MAPK3 Antibody (supplied by: Log in to see )

Antigen
Mitogen-Activated Protein Kinase 3 (MAPK3) Antibodies
  • ERK-1
  • ERK1
  • ERT2
  • HS44KDAP
  • HUMKER1A
  • P44ERK1
  • P44MAPK
  • PRKM3
  • p44-ERK1
  • p44-MAPK
  • Erk-1
  • Erk1
  • Ert2
  • Esrk1
  • Mnk1
  • Mtap2k
  • Prkm3
  • p44
  • p44erk1
  • p44mapk
  • fi06b09
  • wu:fi06b09
  • zERK1
  • Tb08.10J17.940
  • MAPK1
  • MNK1
  • ATMAPK3
  • ATMPK3
  • T6D9.4
  • mitogen-activated protein kinase 3
  • mitogen-activated protein kinase 3
  • mitogen activated protein kinase 3
  • mitogen-activated serine/threonine-protein kinase
  • MAPK3
  • Mapk3
  • mapk3
  • Tc00.1047053509475.10
  • Tb927.8.3550
  • CEK1
  • MPK3
Epitope
AA 336-367
65
49
46
40
21
21
19
18
16
15
14
9
8
5
5
4
4
4
4
3
3
3
3
3
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Hamster, Mouse (Murine), Rabbit, Rat (Rattus)
498
275
211
35
26
24
24
24
20
20
13
12
11
10
9
6
4
4
3
2
2
2
1
1
1
1
Host
Rabbit
337
158
20
6
1
Clonality
Polyclonal
Conjugate
This MAPK3 antibody is un-conjugated
27
25
23
17
16
13
6
6
5
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
2
2
2
2
2
2
2
2
2
2
2
2
2
2
Application
Immunoprecipitation (IP), Immunohistochemistry (IHC), Western Blotting (WB)
422
184
160
102
83
57
54
48
39
16
13
8
7
4
3
2
2
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Catalog No. ABIN351563
$ 581.17
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN966747 IHC Log in to see Polyclonal 0

General

Antigen Mitogen-Activated Protein Kinase 3 (MAPK3) Antibodies
Epitope AA 336-367
(65), (49), (46), (40), (21), (21), (19), (18), (16), (15), (14), (9), (8), (5), (5), (4), (4), (4), (4), (3), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Hamster, Mouse (Murine), Rabbit, Rat (Rattus)
(498), (275), (211), (35), (26), (24), (24), (24), (20), (20), (13), (12), (11), (10), (9), (6), (4), (4), (3), (2), (2), (2), (1), (1), (1), (1)
Host Rabbit
(337), (158), (20), (6), (1)
Clonality
Polyclonal
Conjugate This MAPK3 antibody is un-conjugated
(27), (25), (23), (17), (16), (13), (6), (6), (5), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application Immunoprecipitation (IP), Immunohistochemistry (IHC), Western Blotting (WB)
(422), (184), (160), (102), (83), (57), (54), (48), (39), (16), (13), (8), (7), (4), (3), (2), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-MAPK3 Antibody

Target Details MAPK3 Application Details Handling Images
Specificity This immunoaffinity purified antibody detects ~42kD and ~44kD bands corresponding to Erk1 and Erk2, respectively. The antibody recognizes Erk1 and Erk2 in samples from human, mouse, rat, bovine, chicken, Drosophila, sheep, Xenopus and mussel. Antibody specificity is confirmed by peptide competition studies.
Predicted Reactivity Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%) Monkey, Bovine, Dog, Bat, Horse, Platypus (97%) Human, Gorilla, Gibbon, Elephant (94%) Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%) Xenopus (84%).
Purification Protein A purified
Immunogen A 35 residue synthetic peptide, corresponding to a.a. 333-367 {(CGG)PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP}, of rat Erk1 MAP kinase with the CGG spacer group added and the peptide coupled to KLH. Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%), Monkey, Bovine, Dog, Bat, Horse, Platypus (97%), Human, Gorilla, Gibbon, Elephant (94%), Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%), Xenopus (84%).

Type of Immunogen: Synthetic peptide - KLH conjugated

Target Details MAPK3

Product Details anti-MAPK3 Antibody Application Details Handling Images back to top
Antigen
Alternative Name MAPK3 / ERK1 (MAPK3 Antibody Abstract)
Background Name/Gene ID: MAPK3
Subfamily: MAPK
Family: Protein Kinase

Synonyms: MAPK3, ERK-1, ERT2, HUMKER1A, HS44KDAP, MAP kinase 1, MAP kinase isoform p44, MAPK 1, MAPK 3, p44, p44MAPK, p44-MAPK, p44ERK1, Insulin-stimulated MAP2 kinase, MAP kinase 3, p44-ERK1, ERK1, PRKM3
Gene ID 5595
UniProt P27361
Pathways MAPK Signaling, RTK Signaling, Interferon-gamma Pathway, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals

Application Details

Product Details anti-MAPK3 Antibody Target Details MAPK3 Handling Images back to top
Application Notes Approved: IHC (10 μg/mL), IP (12.5 μg/mL), WB

Usage: Western Blot (Colorimetric): 1 μg/mL 1 μg/mL. Western Blot (ECL). Immunoprecipitation: 12.5 μg/mL. Immunohistochemistry: 10 μg/mL. Positive control: Mouse Brain Tissue Extract.
Restrictions For Research Use only

Handling

Product Details anti-MAPK3 Antibody Target Details MAPK3 Application Details Images back to top
Format Liquid
Concentration Lot specific
Buffer Liquid
Handling Advice Avoid repeat freeze-thaw cycles.
Storage 4 °C,-20 °C
Storage Comment Long term: -20°C
Short term: +4°C. Avoid repeat freeze-thaw cycles.