anti-Human CLIP1 antibody for Immunofluorescence

Recommended CLIP1 Antibody (supplied by: Log in to see )

Antigen
CAP-GLY Domain Containing Linker Protein 1 (CLIP1) Antibodies
  • RSN
  • CLIP1
  • clip170
  • clip-170
  • CLIP
  • CLIP-170
  • CLIP170
  • CYLN1
  • 1110007I12Rik
  • 4631429H07Rik
  • AV017631
  • C81039
  • Clip50
  • Rsn
  • mKIAA4046
  • restin
  • CAP-Gly domain containing linker protein 1
  • CAP-Gly domain-containing linker protein 1
  • CAP-Gly domain containing linker protein 1 L homeolog
  • CAP-GLY domain containing linker protein 1b
  • CAP-GLY domain containing linker protein 1
  • CLIP1
  • LOC100075022
  • clip1
  • clip1.L
  • clip1b
  • Clip1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
76
40
27
7
7
4
4
3
1
1
Host
Rabbit
53
20
2
1
Clonality
Polyclonal
Conjugate
This CLIP1 antibody is un-conjugated
4
3
3
3
3
3
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
71
40
11
10
6
5
3
3
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4299211
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.714434 ABIN1030340 IF ELISA WB Rabbit C-Term Log in to see Polyclonal 0
11.714434 ABIN4299210 ELISA ICC IF WB Rabbit C-Term Log in to see Polyclonal 0
1 ABIN5554699 EIA IF WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN1584260 IF ELISA WB Rabbit Log in to see Polyclonal 0
1 ABIN2234910 IF ELISA WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN1887163 IF ELISA WB Rabbit C-Term Log in to see Polyclonal 0

General

Antigen CAP-GLY Domain Containing Linker Protein 1 (CLIP1) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(76), (40), (27), (7), (7), (4), (4), (3), (1), (1)
Host Rabbit
(53), (20), (2), (1)
Clonality
Polyclonal
Conjugate This CLIP1 antibody is un-conjugated
(4), (3), (3), (3), (3), (3)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(71), (40), (11), (10), (6), (5), (3), (3), (2), (1)
Supplier Log in to see

Product Details anti-CLIP1 Antibody

Target Details CLIP1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KNLELQLKENKRQLSSSSGNTDTQADEDERAQESQIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCDICDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDET
Isotype IgG

Target Details CLIP1

Product Details anti-CLIP1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name CLIP170 (CLIP1 Antibody Abstract)
Background Gene Symbol: CLIP1
Gene ID 6249
Pathways Microtubule Dynamics

Application Details

Product Details anti-CLIP1 Antibody Target Details CLIP1 Handling Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-CLIP1 Antibody Target Details CLIP1 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-CLIP1 Antibody Target Details CLIP1 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-CAP-GLY Domain Containing Linker Protein 1 (CLIP1) antibody (ABIN4299211) Western Blot: CLIP170 Antibody [NBP1-85568] - Lane 1: NIH-3T3 cell lysate (Mouse embr...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-CAP-GLY Domain Containing Linker Protein 1 (CLIP1) antibody (ABIN4299211) Immunohistochemistry-Paraffin: CLIP170 Antibody [NBP1-85568] - Staining of human plac...
Immunofluorescence (IF) image for anti-CAP-GLY Domain Containing Linker Protein 1 (CLIP1) antibody (ABIN4299211) Immunocytochemistry/Immunofluorescence: CLIP170 Antibody [NBP1-85568] - Staining of h...
Western Blotting (WB) image for anti-CAP-GLY Domain Containing Linker Protein 1 (CLIP1) antibody (ABIN4299211) Western Blot: CLIP170 Antibody [NBP1-85568] - Lane 1: Marker [kDa] 230, 130, 95, 72, ...
Immunofluorescence (IF) image for anti-CAP-GLY Domain Containing Linker Protein 1 (CLIP1) antibody (ABIN4299211) Immunocytochemistry/Immunofluorescence: CLIP170 Antibody - Immunofluorescent stainin...