anti-Human MAP1B antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended MAP1B Antibody (supplied by: Log in to see )

Antigen
Microtubule-Associated Protein 1B (MAP1B) Antibodies
  • FUTSCH
  • MAP5
  • Mtap1b
  • A230055D22
  • AI843217
  • LC1
  • Mtap-5
  • Mtap5
  • microtubule associated protein 1B
  • microtubule-associated protein 1B
  • MAP1B
  • Map1b
Reactivity
Human
75
61
51
16
14
13
12
12
2
2
1
1
Host
Rabbit
66
15
Clonality
Polyclonal
Conjugate
This MAP1B antibody is un-conjugated
4
3
3
3
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
44
38
27
14
14
13
13
9
5
3
3
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4332596
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
10.879288 ABIN2451494 IF IHC IHC (p) Mouse IgG1 Log in to see 0
10.879288 ABIN1385602 IF (p) IHC (p) Rabbit IgG AA 490-540 Log in to see Polyclonal 0
1 ABIN448131 IF IHC (p) Mouse IgG1 Log in to see 3G5 0
1 ABIN2451495 IF IHC IHC (p) Mouse IgG1 Log in to see 3G5 0
1 ABIN337155 IF IHC IHC (p) Mouse IgG1 Log in to see 0
1 ABIN5693629 IF IHC (p) Mouse IgG1 Log in to see 3G5 0
1 ABIN6284145 IHC (p) Rabbit IgG AA 480-560 Log in to see Polyclonal 0
1 ABIN1406738 IHC (p) HRP Rabbit IgG AA 490-540 Log in to see Polyclonal 0
1 ABIN5582962 IHC (p) Rabbit IgG Log in to see Polyclonal 0
1 ABIN1388845 IHC (p) Biotin Rabbit IgG AA 490-540 Log in to see Polyclonal 0
1 ABIN385372 IF IHC IHC (p) Biotin Mouse IgG1 Log in to see 3G5 0
1 ABIN187618 IF IHC (p) Mouse IgG1 Log in to see 3G5 0

General

Antigen Microtubule-Associated Protein 1B (MAP1B) Antibodies
Reactivity Human
(75), (61), (51), (16), (14), (13), (12), (12), (2), (2), (1), (1)
Host Rabbit
(66), (15)
Clonality
Polyclonal
Conjugate This MAP1B antibody is un-conjugated
(4), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(44), (38), (27), (14), (14), (13), (13), (9), (5), (3), (3), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-MAP1B Antibody

Target Details MAP1B Application Details Handling References for anti-MAP1B antibody (ABIN4332596) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EVVEEHCASPEDKTLEVVSPSQSVTGSAGHTPYYQSPTDEKSSHLPTEVIEKPPAVPVSFEFSDAKDENERASVSPMDEPVPDSESPIEKVLSPLRSPPLIGSESAYESFLSADDKASGRGAESPFEEKSGKQGSPDQVSPVSEMTST
Isotype IgG
Plasmids, Primers & others

Target Details MAP1B

Product Details anti-MAP1B Antibody Application Details Handling References for anti-MAP1B antibody (ABIN4332596) Images back to top
Antigen
Alternative Name MAP1B (MAP1B Antibody Abstract)
Background Gene Symbol: MAP1B
Gene ID 4131
Pathways Microtubule Dynamics, Regulation of Cell Size

Application Details

Product Details anti-MAP1B Antibody Target Details MAP1B Handling References for anti-MAP1B antibody (ABIN4332596) Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-MAP1B Antibody Target Details MAP1B Application Details References for anti-MAP1B antibody (ABIN4332596) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-MAP1B antibody (ABIN4332596)

Product Details anti-MAP1B Antibody Target Details MAP1B Application Details Handling Images back to top
Product cited in:

Isella, Terrasi, Bellomo, Petti, Galatola, Muratore, Mellano, Senetta, Cassenti, Sonetto, Inghirami, Trusolino, Fekete, De Ridder, Cassoni, Storme, Bertotti, Medico: "Stromal contribution to the colorectal cancer transcriptome." in: Nature genetics, Vol. 47, Issue 4, pp. 312-9, 2015 (Sample species: Human). Further details: Immunohistochemistry

Danielsson, Wiking, Mahdessian, Skogs, Ait Blal, Hjelmare, Stadler, Uhlén, Lundberg: "RNA deep sequencing as a tool for selection of cell lines for systematic subcellular localization of all human proteins." in: Journal of proteome research, Vol. 12, Issue 1, pp. 299-307, 2013

Images

Product Details anti-MAP1B Antibody Target Details MAP1B Application Details Handling References for anti-MAP1B antibody (ABIN4332596) back to top
Supplier Images
Immunofluorescence (IF) image for anti-Microtubule-Associated Protein 1B (MAP1B) antibody (ABIN4332596) Immunocytochemistry/Immunofluorescence: MAP1B Antibody [NBP1-81261] - Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Microtubule-Associated Protein 1B (MAP1B) antibody (ABIN4332596) Immunohistochemistry-Paraffin: MAP1B Antibody [NBP1-81261] - Staining of human cerebr...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Microtubule-Associated Protein 1B (MAP1B) antibody (ABIN4332596) Immunohistochemistry-Paraffin: MAP1B Antibody - Staining of human pancreas shows low...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Microtubule-Associated Protein 1B (MAP1B) antibody (ABIN4332596) Immunohistochemistry-Paraffin: MAP1B Antibody - Staining in human cerebral cortex an...
Western Blotting (WB) image for anti-Microtubule-Associated Protein 1B (MAP1B) antibody (ABIN4332596) Western Blot: MAP1B Antibody - Analysis in U2OS cells transfected with control siRNA...