anti-Mouse (Murine) TUBA3C antibody for Western Blotting

Recommended TUBA3C Antibody (supplied by: Log in to see )

Antigen
Tubulin, Alpha, 3C (TUBA3C) Antibodies
  • TUBA2
  • bA408E5.3
  • TUBA1A
  • TUBA3
  • TUBA3C
  • TUBA4A
  • TUBA3D
  • 3t
  • ALPHA 84D
  • CG2512
  • D.m.ALPHA-84D
  • DTA4
  • Dmel\CG2512
  • T
  • Tub
  • Tub1A
  • aTub84D
  • alpha-Tub
  • alpha-Tub84D
  • alpha-tub
  • alpha-tub84D
  • alpha-tubulin
  • alpha3
  • alpha3t
  • alpha84D
  • alphaTUB
  • alphaTUB84D
  • alphaTub
  • alphaTub3
  • alphaTub84
  • tuba2
  • tuba3c
  • tuba3d
  • GRMZM2G153292
  • TUA2
  • zgc:73108
  • tubulin alpha 3c
  • tubulin, alpha 3A
  • tubulin alpha like 3
  • tubulin alpha-1B chain
  • tubulin alpha-1A chain
  • alpha-Tubulin at 84D
  • tubulin alpha 3c S homeolog
  • tubulin alpha-2 chain-like
  • tubulin, alpha 2
  • TUBA3C
  • Tuba3a
  • TUBAL3
  • LOC610636
  • LOC782966
  • alphaTub84D
  • tuba3c.S
  • LOC103643947
  • tuba2
Epitope
N-Term
13
12
7
6
5
4
3
2
2
2
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus), Caenorhabditis elegans (C. elegans), Fruit Fly (Drosophila melanogaster)
50
7
7
4
4
3
3
3
2
2
2
1
1
1
1
1
1
Host
Rabbit
39
11
Clonality
Polyclonal
Conjugate
This TUBA3C antibody is un-conjugated
3
3
3
2
2
2
Application
Western Blotting (WB)
46
31
8
6
5
2
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN630708
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
16.562979 ABIN630696 WB Rabbit N-Term Log in to see Polyclonal 0
4.8023243 ABIN2785497 WB Rabbit N-Term Log in to see Polyclonal 1
4.8023243 ABIN2785498 WB Rabbit N-Term Log in to see Polyclonal 1
4.8023243 ABIN1077421 ELISA WB Rabbit IgG N-Term Log in to see Polyclonal 0
4.8023243 ABIN2463589 ELISA WB Rabbit Log in to see Polyclonal 0
4 ABIN469624 WB Rabbit AA 35-84 Log in to see Polyclonal 0
1 ABIN1945612 WB Rabbit AA 399-448 Log in to see Polyclonal 0

General

Antigen Tubulin, Alpha, 3C (TUBA3C) Antibodies
Epitope N-Term
(13), (12), (7), (6), (5), (4), (3), (2), (2), (2), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus), Caenorhabditis elegans (C. elegans), Fruit Fly (Drosophila melanogaster)
(50), (7), (7), (4), (4), (3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Host Rabbit
(39), (11)
Clonality
Polyclonal
Conjugate This TUBA3C antibody is un-conjugated
(3), (3), (3), (2), (2), (2)
Application Western Blotting (WB)
(46), (31), (8), (6), (5), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-TUBA3C Antibody

Target Details TUBA3C Application Details Handling Images
Specificity Alpha Tubulin 3 C antibody was raised against the N terminal of TUBA3
Purification Affinity purified
Immunogen alpha Tubulin 3 C antibody was raised using the N terminal of TUBA3 corresponding to a region with amino acids VDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDL
Plasmids, Primers & others

Target Details TUBA3C

Product Details anti-TUBA3C Antibody Application Details Handling Images back to top
Antigen
Background Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species.
Molecular Weight 50 kDa (MW of target protein)
Pathways Microtubule Dynamics

Application Details

Product Details anti-TUBA3C Antibody Target Details TUBA3C Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

alpha Tubulin 3C Blocking Peptide, catalog no. 33R-9469, is also available for use as a blocking control in assays to test for specificity of this alpha Tubulin 3C antibody

Restrictions For Research Use only

Handling

Product Details anti-TUBA3C Antibody Target Details TUBA3C Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBA0 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product Details anti-TUBA3C Antibody Target Details TUBA3C Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Tubulin, Alpha, 3C (TUBA3C) (N-Term) antibody (ABIN630708) alpha Tubulin 3C antibody used at 1 ug/ml to detect target protein.