anti-Caenorhabditis elegans (C. elegans) TUBA4A antibody for Western Blotting

Recommended TUBA4A Antibody (supplied by: Log in to see )

Tubulin, alpha 4a (TUBA4A) Antibodies
  • TUBA1
  • TUBA6
  • H2-ALPHA
  • M[a]4
  • Tuba4
  • tuba1
  • tubulin alpha 1a
  • tubulin alpha 4a
  • tubulin, alpha 4A
  • tubulin alpha 4a L homeolog
  • TUBA1A
  • TUBA4A
  • Tuba4a
  • tuba4a.L
Middle Region
Human, Mouse (Murine), Rat (Rattus), Arabidopsis, Caenorhabditis elegans (C. elegans), Fruit Fly (Drosophila melanogaster)
This TUBA4A antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN631484
$ 473.93
Plus shipping costs $45.00


Antigen Tubulin, alpha 4a (TUBA4A) Antibodies
Epitope Middle Region
(28), (11), (8), (7), (7), (4), (3), (3), (3), (2), (2), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus), Arabidopsis, Caenorhabditis elegans (C. elegans), Fruit Fly (Drosophila melanogaster)
(99), (49), (44), (22), (20), (12), (9), (9), (9), (8), (8), (8), (7), (6), (5), (5), (5), (3), (2), (2), (2), (2), (1), (1), (1)
Host Rabbit
(65), (30), (6)
Conjugate This TUBA4A antibody is un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(91), (44), (43), (40), (19), (14), (7), (7), (4), (2), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-TUBA4A Antibody

Target Details TUBA4A Application Details Handling Images
Specificity Alpha Tubulin 4 A antibody was raised against the middle region of TUBA4
Purification Affinity purified
Immunogen alpha Tubulin 4 A antibody was raised using the middle region of TUBA4 corresponding to a region with amino acids GGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTH
Plasmids, Primers & others

Target Details TUBA4A

Product Details anti-TUBA4A Antibody Application Details Handling Images back to top
Alternative Name alpha Tubulin 4A (TUBA4A Antibody Abstract)
Background Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily.
Molecular Weight 50 kDa (MW of target protein)
Pathways Microtubule Dynamics, M Phase

Application Details

Product Details anti-TUBA4A Antibody Target Details TUBA4A Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

alpha Tubulin 4A Blocking Peptide, catalog no. 33R-3301, is also available for use as a blocking control in assays to test for specificity of this alpha Tubulin 4A antibody

Restrictions For Research Use only


Product Details anti-TUBA4A Antibody Target Details TUBA4A Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBA0 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Product Details anti-TUBA4A Antibody Target Details TUBA4A Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Tubulin, alpha 4a (TUBA4A) (Middle Region) antibody (ABIN631484) alpha Tubulin 4A antibody used at 1 ug/ml to detect target protein.