anti-Fruit Fly (Drosophila melanogaster) TUBE1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended TUBE1 Antibody (supplied by: Log in to see )

Tubulin, epsilon 1 (TUBE1) Antibodies
  • zgc:63582
  • LOC398412
  • TUBE1
  • tube
  • 2310061K05Rik
  • AI551343
  • Tube
  • TUBE
  • dJ142L7.2
  • tubulin, epsilon 1
  • tubulin epsilon 1 L homeolog
  • tubulin epsilon 1
  • epsilon tubulin
  • putative epsilon tubulin
  • Epsilon tubulin
  • tubulin epsilon chain
  • epsilon-tubulin 1
  • tube1
  • tube1.L
  • TUBE1
  • Tc00.1047053509967.160
  • Tc00.1047053509695.120
  • Tb10.70.6950
  • LMJF_21_1010
  • GL50803_6336
  • TUE
  • tubE
  • LOC100541905
  • Tube1
Fruit Fly (Drosophila melanogaster), Human
This TUBE1 antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4891873
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN4270117 IHC IHC (p) WB Rabbit Log in to see Polyclonal 0


Antigen Tubulin, epsilon 1 (TUBE1) Antibodies
Reactivity Fruit Fly (Drosophila melanogaster), Human
(61), (12), (7), (4), (4), (3), (3), (2), (2), (2), (1), (1), (1), (1)
Host Rabbit
(48), (18)
Conjugate This TUBE1 antibody is un-conjugated
(3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(57), (44), (40), (28), (5), (4), (2), (2)
Supplier Log in to see

Product Details anti-TUBE1 Antibody

Target Details TUBE1 Application Details Handling Images
Purification Immunogen affinity purified
Immunogen Synthetic peptides corresponding to TUBE1(tubulin, epsilon 1) The peptide sequence was selected from the middle region of TUBE1. Peptide sequence HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA.

Target Details TUBE1

Product Details anti-TUBE1 Antibody Application Details Handling Images back to top
Alternative Name epsilon 1 Tubulin (TUBE1 Antibody Abstract)
Background Gene Symbol: TUBE1
Gene ID 51175
UniProt Q9UJT0
Pathways Microtubule Dynamics

Application Details

Product Details anti-TUBE1 Antibody Target Details TUBE1 Handling Images back to top
Application Notes Western Blot 0.2-1 μg/mL, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500This is a rabbit polyclonal antibody against TUBE1 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-TUBE1 Antibody Target Details TUBE1 Application Details Images back to top
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.


Product Details anti-TUBE1 Antibody Target Details TUBE1 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Tubulin, epsilon 1 (TUBE1) antibody (ABIN4891873) Western Blot: Epsilon 1 Tubulin Antibody [NBP1-58223] - Titration: 0.2-1 ug/ml, Posit...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Tubulin, epsilon 1 (TUBE1) antibody (ABIN4891873) Immunohistochemistry-Paraffin: Epsilon 1 Tubulin Antibody [NBP1-58223] - Drosophila M...