anti-Fruit Fly (Drosophila melanogaster) TUBE1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended TUBE1 Antibody (supplied by: Log in to see )

Antigen
Tubulin, epsilon 1 (TUBE1) Antibodies
  • zgc:63582
  • LOC398412
  • TUBE1
  • tube
  • 2310061K05Rik
  • AI551343
  • Tube
  • TUBE
  • dJ142L7.2
  • tubulin, epsilon 1
  • tubulin epsilon 1 L homeolog
  • tubulin epsilon 1
  • epsilon tubulin
  • putative epsilon tubulin
  • Epsilon tubulin
  • tubulin epsilon chain
  • epsilon-tubulin 1
  • tube1
  • tube1.L
  • TUBE1
  • Tc00.1047053509967.160
  • Tc00.1047053509695.120
  • Tb10.70.6950
  • LMJF_21_1010
  • GL50803_6336
  • TUE
  • tubE
  • LOC100541905
  • Tube1
Reactivity
Fruit Fly (Drosophila melanogaster), Human
33
16
10
4
4
3
3
2
2
2
1
1
1
Host
Rabbit
20
18
Clonality
Polyclonal
Conjugate
This TUBE1 antibody is un-conjugated
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
31
13
13
9
8
2
2
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4891873
Contact our Customer Service for availability and price in your country.

General

Antigen Tubulin, epsilon 1 (TUBE1) Antibodies
Reactivity Fruit Fly (Drosophila melanogaster), Human
(33), (16), (10), (4), (4), (3), (3), (2), (2), (2), (1), (1), (1)
Host Rabbit
(20), (18)
Clonality
Polyclonal
Conjugate This TUBE1 antibody is un-conjugated
(1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(31), (13), (13), (9), (8), (2), (2), (2), (2), (1)
Supplier Log in to see

Product Details anti-TUBE1 Antibody

Target Details TUBE1 Application Details Handling Images
Purification Immunogen affinity purified
Immunogen Synthetic peptides corresponding to TUBE1(tubulin, epsilon 1) The peptide sequence was selected from the middle region of TUBE1. Peptide sequence HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA.
Plasmids, Primers & others

Target Details TUBE1

Product Details anti-TUBE1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name epsilon 1 Tubulin (TUBE1 Antibody Abstract)
Background Gene Symbol: TUBE1
Gene ID 51175
UniProt Q9UJT0
Pathways Microtubule Dynamics

Application Details

Product Details anti-TUBE1 Antibody Target Details TUBE1 Handling Images back to top
Application Notes Western Blot 0.2-1 μg/mL, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500This is a rabbit polyclonal antibody against TUBE1 and was validated on Western blot.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-TUBE1 Antibody Target Details TUBE1 Application Details Images back to top
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.

Images

Product Details anti-TUBE1 Antibody Target Details TUBE1 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Tubulin, epsilon 1 (TUBE1) antibody (ABIN4891873) Western Blot: Epsilon 1 Tubulin Antibody [NBP1-58223] - Titration: 0.2-1 ug/ml, Posit...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Tubulin, epsilon 1 (TUBE1) antibody (ABIN4891873) Immunohistochemistry-Paraffin: Epsilon 1 Tubulin Antibody [NBP1-58223] - Drosophila M...