anti-Mouse (Murine) ABCC8 antibody for Flow Cytometry

Recommended ABCC8 Antibody (supplied by: Log in to see )

ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 8 (ABCC8) Antibodies
  • ABC36
  • HHF1
  • HI
  • MRP8
  • PHHI
  • SUR
  • SUR1
  • SUR1delta2
  • TNDM2
  • D930031B21Rik
  • Sur
  • Sur1
  • ATP binding cassette subfamily C member 8
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 8
  • ABCC8
  • Abcc8
Human, Mouse (Murine), Rat (Rattus)
This ABCC8 antibody is un-conjugated
Flow Cytometry (FACS), Immunocytochemistry (ICC), Immunohistochemistry (IHC), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Catalog No. ABIN5693055
$ 280.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN5708360 FACS WB Rabbit IgG Log in to see Polyclonal 0


Antigen ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 8 (ABCC8) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(78), (66), (65), (52), (4), (3), (2), (2), (2), (1), (1), (1), (1)
Host Rabbit
(66), (21), (16)
Conjugate This ABCC8 antibody is un-conjugated
(5), (5), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Flow Cytometry (FACS), Immunocytochemistry (ICC), Immunohistochemistry (IHC), Western Blotting (WB)
(96), (67), (53), (34), (28), (5), (2), (2), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-ABCC8 Antibody

Target Details ABCC8 Application Details Handling Images
Brand Picoband™
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for SUR1 detection. Tested with WB, IHC-F, ICC, FCM in Human,Mouse,Rat.
Immunogen A synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKA).

Target Details ABCC8

Product Details anti-ABCC8 Antibody Application Details Handling Images back to top
Alternative Name ABCC8 (ABCC8 Antibody Abstract)

Synonyms: ATP-binding cassette sub-family C member 8, Sulfonylurea receptor 1, ABCC8, HRINS, SUR, SUR1

Background: ATP-binding cassette transporter sub-family C member 8 is a protein that in humans is encoded by the ABCC8 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion. Alternatively spliced transcript variants have been found for this gene.

UniProt Q09428
Pathways Negative Regulation of Hormone Secretion

Application Details

Product Details anti-ABCC8 Antibody Target Details ABCC8 Handling Images back to top
Application Notes

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(F) and ICC.

Application Details: Western blot, 0.1-0.5&mu,g/mL
Immunohistochemistry(Frozen Section), 0.5-1&mu,g/mL
Immunocytochemistry, 0.5-1&mu,g/mL
Flow Cytometry, 1-3 μg/1x106 cells

Restrictions For Research Use only


Product Details anti-ABCC8 Antibody Target Details ABCC8 Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Buffer Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.