anti-Monkey AMH antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended AMH Antibody (supplied by: Log in to see )

Anti-Mullerian Hormone (AMH) Antibodies
  • AMH
  • amh
  • MIF
  • MIS
  • anti-Mullerian hormone
  • amh
  • AMH
  • Amh
Human, Monkey, Mouse (Murine), Sheep (Ovine)
This AMH antibody is un-conjugated
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN317404
$ 786.50
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN490069 IHC (p) WB Rabbit IgG AA 468-517 Log in to see Polyclonal 0
1 ABIN1819771 IHC (p) WB Mouse IgG1 Log in to see 5-6 0


Antigen Anti-Mullerian Hormone (AMH) Antibodies
Reactivity Human, Monkey, Mouse (Murine), Sheep (Ovine)
(103), (68), (33), (5), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Host Mouse
(95), (34), (15), (1)
Clonality (Clone)
Monoclonal   ( )
Conjugate This AMH antibody is un-conjugated
(16), (14), (10), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(120), (63), (41), (17), (15), (13), (9), (4), (4), (3), (2)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-AMH Antibody

Target Details AMH Application Details Handling References for anti-AMH antibody (ABIN317404) Images
Specificity This antibody is specific for Human anti-Mullerian Hormone (AMH), originally classified as a foetal testicular hormone that inhibits Mullerian duct development. AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric 140 kDa disulphide linked precursor that is cleaved to release the mature 30 kDa homodimer.
Cross-Reactivity (Details) Species reactivity (tested):Human, Mouse, Sheep, Monkey
Characteristics Synonyms: Muellerian-inhibiting factor, MIF, MIS, Muellerian-inhibiting substance
Purification Supernatant
Immunogen Synthetic peptide derived from Human AMH. Spleen cells from immunised T/O outbred mice were fused with cells of the SP2/0myeloma cell lineAA Sequence: VPTAYAGKLLISLSEERISAHHVPNMVATEC
Clone 05-06-14
Isotype IgG1

Target Details AMH

Product Details anti-AMH Antibody Application Details Handling References for anti-AMH antibody (ABIN317404) Images back to top
Alternative Name Anti-Muellerian Hormone / AMH (AMH Antibody Abstract)
Background Anti Mullerian Hormone (AMH) is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulphide linked precursor that is cleaved to release the mature 30kD homodimer. Originally classified as a foetal testicular hormone that inhibits Mullerian duct development, AMH is expressed post natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth.Synonyms: MIF, MIS, Muellerian-inhibiting factor, Muellerian-inhibiting substance
Gene ID 268
UniProt P03971
Pathways Negative Regulation of Hormone Secretion

Application Details

Product Details anti-AMH Antibody Target Details AMH Handling References for anti-AMH antibody (ABIN317404) Images back to top
Application Notes Western blot. Immunohistology on Paraffin Sections.1/20-1/40 (Requires antigen retrieval using heattreatment methods prior to staining, Sodium Citrate buffer pH 6.0 is recommended for thispurpose). Recommended Positive Control: Ovary Tissue.
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user.
Restrictions For Research Use only


Product Details anti-AMH Antibody Target Details AMH Application Details References for anti-AMH antibody (ABIN317404) Images back to top
Format Liquid
Buffer 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C/-20 °C
Storage Comment Store the antibody undiluted at 2-8 °C for one month or (in aliquots) at -20 °C for longer. Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Expiry Date 12 months

References for anti-AMH antibody (ABIN317404)

Product Details anti-AMH Antibody Target Details AMH Application Details Handling Images back to top
Background publications

Gruijters, Visser, Durlinger, Themmen: "Anti-Müllerian hormone and its role in ovarian function." in: Molecular and cellular endocrinology, Vol. 211, Issue 1-2, pp. 85-90, 2003

Tabibzadeh: "The signals and molecular pathways involved in human menstruation, a unique process of tissue destruction and remodelling." in: Molecular human reproduction, Vol. 2, Issue 2, pp. 77-92, 1997


Product Details anti-AMH Antibody Target Details AMH Application Details Handling References for anti-AMH antibody (ABIN317404) back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Anti-Mullerian Hormone (AMH) antibody (ABIN317404) anti-Anti-Mullerian Hormone (AMH) antibody