anti-Human PDE8B antibody for Immunocytochemistry

Recommended PDE8B Antibody (supplied by: Log in to see )

phosphodiesterase 8B (PDE8B) Antibodies
  • PDE8B
  • ADSD
  • PPNAD3
  • B230331L10Rik
  • C030047E14Rik
  • phosphodiesterase 8B
  • high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B
  • PDE8B
  • LOC100468338
  • pde8b
  • Pde8b
This PDE8B antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4344454
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN5078698 ICC IF Rabbit IgG Log in to see Polyclonal 0
1 ABIN5558926 CM ELISA ICC IF IHC IP WB Biotin Rabbit Log in to see Polyclonal 0


Antigen phosphodiesterase 8B (PDE8B) Antibodies
Reactivity Human
(28), (23), (8), (6), (4), (4), (4), (3), (3), (2), (2), (2), (2), (1), (1), (1)
Host Rabbit
Conjugate This PDE8B antibody is un-conjugated
(3), (2), (2), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(26), (15), (14), (7), (4), (2), (2), (1)
Supplier Log in to see

Product Details anti-PDE8B Antibody

Target Details PDE8B Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FVSLKKLCCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNRRKESIDVKSISSRGSDAPSLQNRRYPS
Isotype IgG
Plasmids, Primers & others

Target Details PDE8B

Product Details anti-PDE8B Antibody Application Details Handling Images back to top
Alternative Name PDE8B (PDE8B Antibody Abstract)
Background Gene Symbol: PDE8B
Gene ID 8622
Pathways Negative Regulation of Hormone Secretion, cAMP Metabolic Process

Application Details

Product Details anti-PDE8B Antibody Target Details PDE8B Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-PDE8B Antibody Target Details PDE8B Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-PDE8B Antibody Target Details PDE8B Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-phosphodiesterase 8B (PDE8B) antibody (ABIN4344454) Immunohistochemistry-Paraffin: PDE8B Antibody [NBP1-86280] - Staining of human thyroi...
Immunofluorescence (IF) image for anti-phosphodiesterase 8B (PDE8B) antibody (ABIN4344454) Immunocytochemistry/Immunofluorescence: PDE8B Antibody [NBP1-86280] - Immunofluoresce...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-phosphodiesterase 8B (PDE8B) antibody (ABIN4344454) Immunohistochemistry-Paraffin: PDE8B Antibody - Staining of human thyroid gland show...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-phosphodiesterase 8B (PDE8B) antibody (ABIN4344454) Immunohistochemistry-Paraffin: PDE8B Antibody - Staining of human skeletal muscle sh...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-phosphodiesterase 8B (PDE8B) antibody (ABIN4344454) Immunohistochemistry-Paraffin: PDE8B Antibody - Staining of human thyroid gland show...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-phosphodiesterase 8B (PDE8B) antibody (ABIN4344454) Immunohistochemistry-Paraffin: PDE8B Antibody - Staining in human thyroid gland and ...