anti-Human SYTL4 antibody for Immunofluorescence

Recommended SYTL4 Antibody (supplied by: Log in to see )

Antigen
Synaptotagmin-Like 4 (SYTL4) Antibodies
  • slp4
  • SLP4
  • Gph
  • Slp4
  • synaptotagmin like 4
  • synaptotagmin like 4 L homeolog
  • synaptotagmin-like 4
  • SYTL4
  • sytl4.L
  • Sytl4
Reactivity
Human
36
12
11
Host
Rabbit
36
Clonality
Polyclonal
Conjugate
This SYTL4 antibody is un-conjugated
2
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
32
30
9
4
3
2
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4357440
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
10.579316 ABIN4357439 ICC IF IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN6259283 ELISA ICC IF WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN5589117 IF IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN5589118 IF IHC (p) WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen Synaptotagmin-Like 4 (SYTL4) Antibodies
Reactivity Human
(36), (12), (11)
Host Rabbit
(36)
Clonality
Polyclonal
Conjugate This SYTL4 antibody is un-conjugated
(2), (2), (2), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(32), (30), (9), (4), (3), (2)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-SYTL4 Antibody

Target Details SYTL4 Application Details Handling References for anti-SYTL4 antibody (ABIN4357440) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GKSALEAESESLDSFTADSDSTSRRDSLDKSGLFPEWKKMSAPKSQVEKETQPGGQNVVFVDEGEMIFKKNTRKILRPSEYTKSVIDLRPEDVVHESGSLGDRSKSVPGLNVDMEEEEEEEDIDHLVKLHRQKLARSSMQSGSSM
Isotype IgG
Plasmids, Primers & others

Target Details SYTL4

Product Details anti-SYTL4 Antibody Application Details Handling References for anti-SYTL4 antibody (ABIN4357440) Images back to top
Antigen
Alternative Name SYTL4 (SYTL4 Antibody Abstract)
Background Gene Symbol: SYTL4
Gene ID 94121
Pathways Negative Regulation of Hormone Secretion

Application Details

Product Details anti-SYTL4 Antibody Target Details SYTL4 Handling References for anti-SYTL4 antibody (ABIN4357440) Images back to top
Application Notes Western Blot 1:250 - 1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-SYTL4 Antibody Target Details SYTL4 Application Details References for anti-SYTL4 antibody (ABIN4357440) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-SYTL4 antibody (ABIN4357440)

Product Details anti-SYTL4 Antibody Target Details SYTL4 Application Details Handling Images back to top
Product cited in:

Mosedale, Egodage, Calma, Chi, Chessler: "Neurexin-1? contributes to insulin-containing secretory granule docking." in: The Journal of biological chemistry, Vol. 287, Issue 9, pp. 6350-61, 2012

Salazar, Zlatic, Craige, Peden, Pohl, Faundez: "Hermansky-Pudlak syndrome protein complexes associate with phosphatidylinositol 4-kinase type II alpha in neuronal and non-neuronal cells." in: The Journal of biological chemistry, Vol. 284, Issue 3, pp. 1790-802, 2009

Images

Product Details anti-SYTL4 Antibody Target Details SYTL4 Application Details Handling References for anti-SYTL4 antibody (ABIN4357440) back to top
Supplier Images
Immunofluorescence (IF) image for anti-Synaptotagmin-Like 4 (SYTL4) antibody (ABIN4357440) Immunocytochemistry/Immunofluorescence: SYTL4 Antibody - Staining of human cell line...