anti-Mouse (Murine) UCP2 antibody for Western Blotting

Recommended UCP2 Antibody (supplied by: Log in to see )

Uncoupling Protein 2 (Mitochondrial, Proton Carrier) (UCP2) Antibodies
  • UCP2
  • DKFZp470P1633
  • ucp2
  • MGC53319
  • MGC75881
  • cb74
  • ATUCP2
  • K19M22.21
  • K19M22_21
  • uncoupling protein 2
  • BMIQ4
  • SLC25A8
  • UCPH
  • Slc25a8
  • mitochondrial uncoupling protein 2
  • uncoupling protein 2
  • uncoupling protein 2 (mitochondrial, proton carrier) L homeolog
  • uncoupling protein 2 (mitochondrial, proton carrier)
  • uncoupling protein 1
  • PTRG_09289
  • UCP2
  • LOC100282746
  • ucp2.L
  • ucp2
  • ucp1
  • Ucp2
AA 134-170, Middle Region
Human, Mouse (Murine), Rat (Rattus)
This UCP2 antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5518965
$ 240.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
3.1679735 ABIN1175761 ICC IHC WB Rabbit IgG AA 150-304 Log in to see Polyclonal 0
3.1679735 ABIN1875269 IHC WB Rabbit IgG Log in to see Polyclonal 0
3.1679735 ABIN5629187 ELISA ICC IF WB Goat Log in to see Polyclonal 0
3.1679735 ABIN2560660 ELISA WB Goat IgG Internal Region Log in to see Polyclonal 0
1 ABIN461943 ELISA IHC IHC (p) WB Goat AA 101-113 Log in to see Polyclonal 0
1 ABIN675428 IF (p) IHC (p) WB Rabbit IgG AA 236-268 Log in to see Polyclonal 2
1 ABIN1740576 IHC (p) ELISA WB Goat Internal Region Log in to see Polyclonal 0
1 ABIN214924 ELISA WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN218832 ELISA WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN5553326 ELISA WB Goat Internal Region Log in to see Polyclonal 0
1 ABIN2569826 WB Rabbit IgG AA 150-304 Log in to see Polyclonal 0
1 ABIN675437 IHC (p) WB HRP Rabbit IgG AA 236-268 Log in to see Polyclonal 0
1 ABIN2629746 WB FITC Rabbit IgG AA 150-304 Log in to see Polyclonal 0
1 ABIN2629743 WB Biotin Rabbit IgG AA 150-304 Log in to see Polyclonal 0
1 ABIN960732 ELISA WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN675430 IHC (p) WB Biotin Rabbit IgG AA 236-268 Log in to see Polyclonal 0
1 ABIN5972310 IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN5699615 ELISA IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2859404 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN5958545 ELISA IHC WB Rabbit IgG Log in to see Polyclonal 0


Antigen Uncoupling Protein 2 (Mitochondrial, Proton Carrier) (UCP2) Antibodies
Epitope AA 134-170, Middle Region
(15), (15), (13), (7), (7), (5), (5), (4), (4), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(129), (58), (50), (5), (1), (1), (1), (1), (1), (1), (1), (1)
Host Rabbit
(83), (54), (20), (2)
Conjugate This UCP2 antibody is un-conjugated
(14), (8), (5), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(124), (94), (77), (39), (13), (11), (11), (9), (6), (6), (2), (2)
Supplier Log in to see

Product Details anti-UCP2 Antibody

Target Details UCP2 Application Details Handling Images
Purpose Rabbit IgG polyclonal antibody for Mitochondrial uncoupling protein 2(UCP2) detection. Tested with WB in Human,Mouse,Rat.
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Mitochondrial uncoupling protein 2(UCP2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: uncoupling protein 2
Protein Name: Mitochondrial uncoupling protein 2
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human UCP2 (134-170aa AQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREE), different from the related mouse and rat sequences by one amino acid.
Isotype IgG
Plasmids, Primers & others

Target Details UCP2

Product Details anti-UCP2 Antibody Application Details Handling Images back to top
Alternative Name UCP2 (UCP2 Antibody Abstract)
Background Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed in many tissues, with the greatest expression in skeletal muscle. It is thought to play a role in nonshivering thermogenesis, obesity and diabetes. Chromosomal order is 5'-UCP3-UCP2-3'.

Synonyms: Mitochondrial uncoupling protein 2, UCP 2, Solute carrier family 25 member 8, UCPH, UCP2, SLC25A8
Gene ID 7351
UniProt P55851
Pathways Negative Regulation of Hormone Secretion, Carbohydrate Homeostasis, Proton Transport

Application Details

Product Details anti-UCP2 Antibody Target Details UCP2 Handling Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions For Research Use only


Product Details anti-UCP2 Antibody Target Details UCP2 Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.


Product Details anti-UCP2 Antibody Target Details UCP2 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Uncoupling Protein 2 (Mitochondrial, Proton Carrier) (UCP2) (AA 134-170), (Middle Region) antibody (ABIN5518965) Western blot analysis of UCP2 using anti-UCP2 antibody . Electrophoresis was perform...