anti-Human Urotensin 2 antibody for Immunofluorescence

Recommended Urotensin 2 Antibody (supplied by: Log in to see )

Antigen
Urotensin 2 (UTS2) Antibodies
  • UTS2
  • ucn2
  • PRO1068
  • U-II
  • UCN2
  • UII
  • Ucn2
  • prepro-UII
  • urotensin 2
  • UTS2
  • uts2
  • Uts2
Reactivity
Human
90
11
10
5
2
Host
Rabbit
97
7
Clonality
Polyclonal
Conjugate
This Urotensin 2 antibody is un-conjugated
7
4
3
3
3
3
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
42
41
29
6
5
5
3
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Catalog No. ABIN4364515
Contact our Customer Service for availability and price in your country.

General

Antigen Urotensin 2 (UTS2) Antibodies
Reactivity Human
(90), (11), (10), (5), (2)
Host Rabbit
(97), (7)
Clonality
Polyclonal
Conjugate This Urotensin 2 antibody is un-conjugated
(7), (4), (3), (3), (3), (3)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(42), (41), (29), (6), (5), (5), (3), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-Urotensin 2 Antibody

Target Details Urotensin 2 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TNVFHLMLCVTSARTHKSTSLCFGHFNSYPSLPLIHDLLLEISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV
Isotype IgG
Plasmids, Primers & others

Target Details Urotensin 2

Product Details anti-Urotensin 2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name Urotensin-2 (UTS2 Antibody Abstract)
Background Gene Symbol: UTS2
Gene ID 10911
Pathways Negative Regulation of Hormone Secretion

Application Details

Product Details anti-Urotensin 2 Antibody Target Details Urotensin 2 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Urotensin 2 Antibody Target Details Urotensin 2 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.