anti-Human IVNS1ABP antibody for Immunofluorescence

Recommended IVNS1ABP Antibody (supplied by: Log in to see )

Antigen
Influenza Virus NS1A Binding Protein (IVNS1ABP) Antibodies
  • FLARA3
  • HSPC068
  • KLHL39
  • ND1
  • NS-1
  • NS1-BP
  • NS1BP
  • 1190004M08Rik
  • 1700126I16Rik
  • AA960440
  • Nd1-L
  • Nd1-S
  • mKIAA0850
  • cb1052
  • fj23g11
  • ivns1abp
  • wu:fj23g11
  • influenza virus NS1A binding protein
  • influenza virus NS1A binding protein L homeolog
  • influenza virus NS1A binding protein a
  • IVNS1ABP
  • Ivns1abp
  • ivns1abp.L
  • ivns1abpa
Reactivity
Human
24
14
11
8
5
5
4
3
3
3
2
1
1
1
1
Host
Rabbit
25
1
Clonality
Polyclonal
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
26
15
8
6
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN4340709
Contact our Customer Service for availability and price in your country.

General

Antigen Influenza Virus NS1A Binding Protein (IVNS1ABP) Antibodies
Reactivity Human
(24), (14), (11), (8), (5), (5), (4), (3), (3), (3), (2), (1), (1), (1), (1)
Host Rabbit
(25), (1)
Clonality
Polyclonal
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(26), (15), (8), (6), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-IVNS1ABP Antibody

Target Details IVNS1ABP Application Details Handling References for anti-IVNS1ABP antibody (ABIN4340709) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QDELIEKPMSPMQYARSGLGTAEMNGKLIAAGGYNREECLRTVECYNPHTDHWSFLAPMRTPRARFQMAVLMGQLYVVGGSNGHSDDLSCGEMYDSNIDDWIPVPELRTNRCNAGVCALNGKLYIVGGSD
Isotype IgG
Plasmids, Primers & others

Target Details IVNS1ABP

Product Details anti-IVNS1ABP Antibody Application Details Handling References for anti-IVNS1ABP antibody (ABIN4340709) Images back to top
Antigen
Alternative Name NS1-BP (IVNS1ABP Antibody Abstract)
Background Gene Symbol: IVNS1ABP
Gene ID 10625
Pathways Negative Regulation of intrinsic apoptotic Signaling

Application Details

Product Details anti-IVNS1ABP Antibody Target Details IVNS1ABP Handling References for anti-IVNS1ABP antibody (ABIN4340709) Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-IVNS1ABP Antibody Target Details IVNS1ABP Application Details References for anti-IVNS1ABP antibody (ABIN4340709) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-IVNS1ABP antibody (ABIN4340709)

Product Details anti-IVNS1ABP Antibody Target Details IVNS1ABP Application Details Handling Images back to top
Product cited in:

Perisic, Hedin, Razuvaev, Lengquist, Osterholm, Folkersen, Gillgren, Paulsson-Berne, Ponten, Odeberg, Hedin: "Profiling of atherosclerotic lesions by gene and tissue microarrays reveals PCSK6 as a novel protease in unstable carotid atherosclerosis." in: Arteriosclerosis, thrombosis, and vascular biology, Vol. 33, Issue 10, pp. 2432-43, 2013

Images

Product Details anti-IVNS1ABP Antibody Target Details IVNS1ABP Application Details Handling References for anti-IVNS1ABP antibody (ABIN4340709) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Influenza Virus NS1A Binding Protein (IVNS1ABP) antibody (ABIN4340709) Immunohistochemistry-Paraffin: NS1-BP Antibody [NBP1-83180] - Staining of human rectu...
Immunofluorescence (IF) image for anti-Influenza Virus NS1A Binding Protein (IVNS1ABP) antibody (ABIN4340709) Immunocytochemistry/Immunofluorescence: NS1-BP Antibody [NBP1-83180] - Staining of hu...
Western Blotting (WB) image for anti-Influenza Virus NS1A Binding Protein (IVNS1ABP) antibody (ABIN4340709) Western Blot: NS1-BP Antibody [NBP1-83180] - Lane 1: Marker [kDa] 230, 110, 82, 49, 3...
Western Blotting (WB) image for anti-Influenza Virus NS1A Binding Protein (IVNS1ABP) antibody (ABIN4340709) Western Blot: NS1-BP Antibody - Analysis in control (vector only transfected HEK293T...