anti-Rat (Rattus) EGFR antibody for Immunocytochemistry

Recommended EGFR Antibody (supplied by: Log in to see )

Antigen
Epidermal Growth Factor Receptor (EGFR) Antibodies
  • C-erb
  • CG10079
  • D-EGFR
  • D-Egf
  • DEGFR
  • DER
  • DER flb
  • DER/EGFR
  • DER/faint little ball
  • DER/top
  • DER/torpedo
  • DER1
  • DEgfr
  • Degfr
  • Der
  • DmHD-33
  • Dmel\\CG10079
  • EFG-R
  • EGF-R
  • EGFR
  • EGFr
  • EGfr
  • EK2-6
  • Egf
  • Egf-r
  • EgfR
  • El
  • Elp
  • Elp-1
  • Elp-B1
  • Elp-B1RB1
  • HD-33
  • TOP
  • Torpedo/DER
  • Torpedo/Egfr
  • c-erbB
  • d-egf-r
  • dEGFR
  • dEGFR1
  • dEgfr
  • der
  • egfr
  • flb
  • l(2)05351
  • l(2)09261
  • l(2)57DEFa
  • l(2)57EFa
  • l(2)57Ea
  • mor1
  • top
  • top/DER
  • top/flb
  • torpedo/Egfr
  • torpedo/egfr
  • EGFR12
  • EGFR15
  • egfr1
  • Erbb2
  • ERBB
  • ERBB1
  • HER1
  • PIG61
  • mENA
  • ErbB-1
  • Errp
  • 9030024J15Rik
  • AI552599
  • Erbb
  • Errb1
  • Wa5
  • wa-2
  • wa2
  • epidermal growth factor receptor
  • Epidermal growth factor receptor
  • epidermal growth factor receptor a (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian)
  • EGFR
  • Egfr
  • egfra
  • egfr1
  • LOC5564544
Reactivity
Human, Mouse (Murine), Rat (Rattus)
2488
889
718
26
25
18
17
14
12
7
2
2
2
1
1
1
1
Host
Rabbit
1512
867
84
44
12
5
2
1
1
Clonality
Polyclonal
Conjugate
This EGFR antibody is un-conjugated
102
83
74
65
56
54
54
32
32
28
28
28
28
28
28
28
26
25
24
24
21
21
21
21
21
21
20
18
17
17
2
2
2
2
2
2
2
2
2
2
2
2
2
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
1545
708
667
620
553
281
272
227
133
89
67
55
43
40
19
14
12
11
9
4
4
4
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4307205
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN457474 ELISA ICC IF IHC IHC (p) IP WB Sheep IgG Internal Region Log in to see Polyclonal 0
1 ABIN265742 ICC IF IHC (p) IHC ELISA WB Mouse IgG1 Log in to see 29-1 2
1 ABIN2736680 ICC IP IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN364308 ICC IHC IHC (p) IP WB Sheep Internal Region Log in to see Polyclonal 0
1 ABIN1825914 ICC IHC WB Rabbit pSer1070 Log in to see Polyclonal 0
1 ABIN1733923 ICC IF IHC (p) IP ELISA WB Sheep IgG Internal Region Log in to see Polyclonal 0
1 ABIN343626 ICC WB Rabbit IgG Log in to see Polyclonal 2
1 ABIN4307181 ICC IF IHC IHC (p) WB Rabbit Log in to see Polyclonal 0
1 ABIN2740514 ICC IF IHC IHC (p) WB Rabbit pThr693 Log in to see Polyclonal 0
1 ABIN1733924 ICC IHC (p) IP WB Sheep Internal Region Log in to see Polyclonal 0
1 ABIN2470777 ICC IF IP IHC ELISA WB Sheep IgG Internal Region Log in to see Polyclonal 0
1 ABIN2471324 ICC IP IHC WB Sheep Internal Region Log in to see Polyclonal 0
1 ABIN4307187 ICC IF IHC IHC (p) WB Rabbit Log in to see Polyclonal 0
1 ABIN5681265 ICC IF WB Rabbit pTyr1068 Log in to see Polyclonal 0
1 ABIN5681266 ICC IF IHC IHC (fro) IHC (p) WB Rabbit pTyr1173 Log in to see Polyclonal 0
1 ABIN4307204 ICC IF IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1112884 ICC FACS WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1576216 ICC FACS WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2857816 ICC IF WB Rabbit pThr678 Log in to see Polyclonal 0
1 ABIN2857818 ICC IF IHC WB Rabbit pTyr1016 Log in to see Polyclonal 0

General

Antigen Epidermal Growth Factor Receptor (EGFR) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(2488), (889), (718), (26), (25), (18), (17), (14), (12), (7), (2), (2), (2), (1), (1), (1), (1)
Host Rabbit
(1512), (867), (84), (44), (12), (5), (2), (1), (1)
Clonality
Polyclonal
Conjugate This EGFR antibody is un-conjugated
(102), (83), (74), (65), (56), (54), (54), (32), (32), (28), (28), (28), (28), (28), (28), (28), (26), (25), (24), (24), (21), (21), (21), (21), (21), (21), (20), (18), (17), (17), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(1545), (708), (667), (620), (553), (281), (272), (227), (133), (89), (67), (55), (43), (40), (19), (14), (12), (11), (9), (4), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-EGFR Antibody

Target Details EGFR Application Details Handling References for anti-EGFR antibody (ABIN4307205) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids 1019-1168 of human EGFR's cytoplasmic domain (UniProtKB - P00533): QQGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLD
Isotype IgG

Target Details EGFR

Product Details anti-EGFR Antibody Application Details Handling References for anti-EGFR antibody (ABIN4307205) Images back to top
Antigen
Alternative Name EGF R/ErbB1 (EGFR Antibody Abstract)
Background Gene Symbol: EGFR
Gene ID 1956
UniProt P00533
Pathways NF-kappaB Signaling, RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Stem Cell Maintenance, Hepatitis C, Positive Regulation of Response to DNA Damage Stimulus, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling, EGFR Downregulation

Application Details

Product Details anti-EGFR Antibody Target Details EGFR Handling References for anti-EGFR antibody (ABIN4307205) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-EGFR Antibody Target Details EGFR Application Details References for anti-EGFR antibody (ABIN4307205) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-EGFR antibody (ABIN4307205)

Product Details anti-EGFR Antibody Target Details EGFR Application Details Handling Images back to top
Product cited in:

Luke, Myers, Emelianov, Sokolov: "Sentinel lymph node biopsy revisited: ultrasound-guided photoacoustic detection of micrometastases using molecularly targeted plasmonic nanosensors." in: Cancer research, Vol. 74, Issue 19, pp. 5397-408, 2014 (Sample species: Mouse (Murine)). Further details: Immunohistochemistry

Arabi, Ullah, Branca, Johansson, Bandarra, Haneklaus, Fu, Ariës, Nilsson, Den Boer, Pokrovskaja, Grandér, Xiao, Rocha, Lehtiö, Sangfelt: "Proteomic screen reveals Fbw7 as a modulator of the NF-κB pathway." in: Nature communications, Vol. 3, pp. 976, 2012

Images

Product Details anti-EGFR Antibody Target Details EGFR Application Details Handling References for anti-EGFR antibody (ABIN4307205) back to top
Supplier Images
Western Blotting (WB) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Western Blot: EGF R/ErbB1 Antibody [NBP1-84814] - Lane 1: Marker [kDa] 230, 130, 95, ...
Western Blotting (WB) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Western Blot: EGF R/ErbB1 Antibody [NBP1-84814] - Lane 1: NIH-3T3 cell lysate (Mouse ...
Immunofluorescence (IF) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Immunocytochemistry/Immunofluorescence: EGF R/ErbB1 Antibody [NBP1-84814] - Staining ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Immunohistochemistry-Paraffin: EGF R/ErbB1 Antibody [NBP1-84814] - Staining of human ...
Western Blotting (WB) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Western Blot: EGFR Antibody - Analysis in mouse cell line NIH-3T3 and rat cell line ...
Western Blotting (WB) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Western Blot: EGFR Antibody - Analysis in human cell line A-549.
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Immunohistochemistry-Paraffin: EGFR Antibody - Staining in human placenta and tonsil...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Immunohistochemistry-Paraffin: EGFR Antibody - Staining of human tonsil shows low ex...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Immunohistochemistry-Paraffin: EGFR Antibody - Staining of human placenta shows high...