anti-Rat (Rattus) EGFR antibody for Immunocytochemistry

Recommended EGFR Antibody (supplied by: Log in to see )

Antigen
Epidermal Growth Factor Receptor (EGFR) Antibodies
  • C-erb
  • CG10079
  • D-EGFR
  • D-Egf
  • DEGFR
  • DER
  • DER flb
  • DER/EGFR
  • DER/faint little ball
  • DER/top
  • DER/torpedo
  • DER1
  • DEgfr
  • Degfr
  • Der
  • DmHD-33
  • Dmel\\CG10079
  • EFG-R
  • EGF-R
  • EGFR
  • EGFr
  • EGfr
  • EK2-6
  • Egf
  • Egf-r
  • EgfR
  • El
  • Elp
  • Elp-1
  • Elp-B1
  • Elp-B1RB1
  • HD-33
  • TOP
  • Torpedo/DER
  • Torpedo/Egfr
  • c-erbB
  • d-egf-r
  • dEGFR
  • dEGFR1
  • dEgfr
  • der
  • egfr
  • flb
  • l(2)05351
  • l(2)09261
  • l(2)57DEFa
  • l(2)57EFa
  • l(2)57Ea
  • mor1
  • top
  • top/DER
  • top/flb
  • torpedo/Egfr
  • torpedo/egfr
  • EGFR12
  • EGFR15
  • egfr1
  • Erbb2
  • ERBB
  • ERBB1
  • HER1
  • PIG61
  • mENA
  • ErbB-1
  • Errp
  • 9030024J15Rik
  • AI552599
  • Erbb
  • Errb1
  • Wa5
  • wa-2
  • wa2
  • epidermal growth factor receptor
  • Epidermal growth factor receptor
  • epidermal growth factor receptor a (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian)
  • EGFR
  • Egfr
  • egfra
  • egfr1
  • LOC5564544
Reactivity
Human, Mouse (Murine), Rat (Rattus)
2708
961
788
31
27
20
19
16
14
7
4
3
2
2
2
2
2
2
2
1
1
1
1
1
Host
Rabbit
1584
1015
82
44
14
5
2
1
1
Clonality
Polyclonal
Conjugate
This EGFR antibody is un-conjugated
110
83
82
72
62
56
54
36
32
32
29
28
28
28
28
28
28
26
25
24
24
21
21
21
21
21
20
18
17
17
8
8
8
8
8
8
8
8
8
8
8
8
8
2
2
2
2
2
2
2
2
2
2
2
2
2
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
1650
828
721
682
546
422
272
255
144
89
86
60
55
40
26
22
19
11
10
9
8
4
4
3
3
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4307205
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN343626 ICC WB Rabbit IgG Log in to see Polyclonal 2
1 ABIN457474 ELISA ICC IF IHC IHC (p) IP WB Sheep IgG Internal Region Log in to see Polyclonal 0
1 ABIN265742 ICC IF IHC (p) IHC ELISA WB Mouse IgG1 Log in to see 29-1 2
1 ABIN2736680 ICC IP IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN364308 ICC IHC IHC (p) IP WB Sheep Internal Region Log in to see Polyclonal 0
1 ABIN6255725 ELISA ICC IF WB Rabbit IgG pThr678 Log in to see Polyclonal 0
1 ABIN6255773 ELISA ICC IF WB Rabbit IgG pTyr1110 Log in to see Polyclonal 0
1 ABIN6256097 ELISA ICC IF IHC WB Rabbit IgG pSer1070 Log in to see Polyclonal 0
1 ABIN6256596 ELISA ICC IF IHC WB Rabbit IgG pThr693 Log in to see Polyclonal 0
1 ABIN6255771 ELISA ICC IF IHC WB Rabbit IgG pTyr1092 Log in to see Polyclonal 0
1 ABIN6256611 ELISA ICC IF IHC WB Rabbit IgG pTyr1016 Log in to see Polyclonal 0
1 ABIN6256621 ELISA ICC IF WB Rabbit IgG pTyr1172 Log in to see Polyclonal 0
1 ABIN6255471 ELISA ICC IF IHC WB Rabbit IgG pSer695 Log in to see Polyclonal 0
1 ABIN6256051 ELISA ICC IF WB Rabbit IgG pTyr869 Log in to see Polyclonal 0
1 ABIN6254923 ELISA ICC IF IHC WB Rabbit IgG pSer1026 Log in to see Polyclonal 0
1 ABIN6256098 ELISA ICC IF IHC WB Rabbit IgG pSer1071 Log in to see Polyclonal 0
1 ABIN6256624 ELISA ICC IF IHC WB Rabbit IgG pTyr1197 Log in to see Polyclonal 0
1 ABIN6255768 ELISA ICC IF WB Rabbit IgG pTyr1068 Log in to see Polyclonal 0
1 ABIN6271386 ELISA ICC IF IHC WB Rabbit IgG pTyr998 Log in to see Polyclonal 0
1 ABIN6261460 ELISA ICC IF WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen Epidermal Growth Factor Receptor (EGFR) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(2708), (961), (788), (31), (27), (20), (19), (16), (14), (7), (4), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(1584), (1015), (82), (44), (14), (5), (2), (1), (1)
Clonality
Polyclonal
Conjugate This EGFR antibody is un-conjugated
(110), (83), (82), (72), (62), (56), (54), (36), (32), (32), (29), (28), (28), (28), (28), (28), (28), (26), (25), (24), (24), (21), (21), (21), (21), (21), (20), (18), (17), (17), (8), (8), (8), (8), (8), (8), (8), (8), (8), (8), (8), (8), (8), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(1650), (828), (721), (682), (546), (422), (272), (255), (144), (89), (86), (60), (55), (40), (26), (22), (19), (11), (10), (9), (8), (4), (4), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-EGFR Antibody

Target Details EGFR Application Details Handling References for anti-EGFR antibody (ABIN4307205) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids 1019-1168 of human EGFR's cytoplasmic domain (UniProtKB - P00533): QQGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLD
Isotype IgG
Plasmids, Primers & others

Target Details EGFR

Product Details anti-EGFR Antibody Application Details Handling References for anti-EGFR antibody (ABIN4307205) Images back to top
Antigen
Alternative Name EGF R/ErbB1 (EGFR Antibody Abstract)
Background Gene Symbol: EGFR
Gene ID 1956
UniProt P00533
Pathways NF-kappaB Signaling, RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Stem Cell Maintenance, Hepatitis C, Positive Regulation of Response to DNA Damage Stimulus, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling, EGFR Downregulation

Application Details

Product Details anti-EGFR Antibody Target Details EGFR Handling References for anti-EGFR antibody (ABIN4307205) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-EGFR Antibody Target Details EGFR Application Details References for anti-EGFR antibody (ABIN4307205) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-EGFR antibody (ABIN4307205)

Product Details anti-EGFR Antibody Target Details EGFR Application Details Handling Images back to top
Product cited in:

Luke, Myers, Emelianov, Sokolov: "Sentinel lymph node biopsy revisited: ultrasound-guided photoacoustic detection of micrometastases using molecularly targeted plasmonic nanosensors." in: Cancer research, Vol. 74, Issue 19, pp. 5397-408, 2014 (Sample species: Mouse (Murine)). Further details: Immunohistochemistry

Arabi, Ullah, Branca, Johansson, Bandarra, Haneklaus, Fu, Ariës, Nilsson, Den Boer, Pokrovskaja, Grandér, Xiao, Rocha, Lehtiö, Sangfelt: "Proteomic screen reveals Fbw7 as a modulator of the NF-κB pathway." in: Nature communications, Vol. 3, pp. 976, 2012

Images

Product Details anti-EGFR Antibody Target Details EGFR Application Details Handling References for anti-EGFR antibody (ABIN4307205) back to top
Supplier Images
Western Blotting (WB) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Western Blot: EGF R/ErbB1 Antibody [NBP1-84814] - Lane 1: Marker [kDa] 230, 130, 95, ...
Western Blotting (WB) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Western Blot: EGF R/ErbB1 Antibody [NBP1-84814] - Lane 1: NIH-3T3 cell lysate (Mouse ...
Immunofluorescence (IF) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Immunocytochemistry/Immunofluorescence: EGF R/ErbB1 Antibody [NBP1-84814] - Staining ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Immunohistochemistry-Paraffin: EGF R/ErbB1 Antibody [NBP1-84814] - Staining of human ...
Western Blotting (WB) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Western Blot: EGFR Antibody - Analysis in mouse cell line NIH-3T3 and rat cell line ...
Western Blotting (WB) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Western Blot: EGFR Antibody - Analysis in human cell line A-549.
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Immunohistochemistry-Paraffin: EGFR Antibody - Staining in human placenta and tonsil...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Immunohistochemistry-Paraffin: EGFR Antibody - Staining of human tonsil shows low ex...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Epidermal Growth Factor Receptor (EGFR) antibody (ABIN4307205) Immunohistochemistry-Paraffin: EGFR Antibody - Staining of human placenta shows high...