anti-Human Growth Hormone Receptor antibody for Immunocytochemistry
Recommended Growth Hormone Receptor Antibody (supplied by: Log in to see )
- Antigen
-
Growth Hormone Receptor (GHR) Antibodies
show synonyms for this antigen- GHBP
- AA986417
- GHR/BP
- GHR
- ghr
- ghr.a
- zgc:162141
- growth hormone receptor
- growth hormone receptor L homeolog
- growth hormone receptor a
- GHR
- Ghr
- ghr.L
- ghr
- ghra
- Reactivity
-
Human
Alternatives - Host
-
Rabbit
Alternatives - Clonality
- Conjugate
-
This Growth Hormone Receptor antibody is un-conjugated
Alternatives - Application
-
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Alternatives - Supplier
- Log in to see
- Supplier Product No.
- Log in to see
Get this product for free
Submit your validation data for this product and get a full refund. I want to validate this productAvailable images
Catalog No. ABIN5077057
Contact our Customer Service for availability and price in your country.
| Relevance Score | ABIN | Application | Conjugate | Host | Isotype | Epitope | Supplier | Clonality | References | Details |
|---|---|---|---|---|---|---|---|---|---|---|
| 1 | ABIN1859006 | ICC IHC WB | Rabbit | IgG | AA 315-574 | Log in to see | Polyclonal | 0 | ||
| 1 | ABIN5077058 | ICC IF | Rabbit | IgG | Log in to see | Polyclonal | 0 |
General |
|
|---|---|
| Antigen | Growth Hormone Receptor (GHR) Antibodies |
| Reactivity | Human Alternatives |
| Host | Rabbit Alternatives |
| Clonality | |
| Conjugate | This Growth Hormone Receptor antibody is un-conjugated Alternatives |
| Application |
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Alternatives
|
| Supplier | Log in to see |
Product Details anti-Growth Hormone Receptor AntibodyTarget Details Growth Hormone Receptor Application Details Handling Images |
|
| Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Purification | Affinity purified |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQF |
| Isotype | IgG |
| Plasmids, Primers & others | |
Target Details Growth Hormone ReceptorProduct Details anti-Growth Hormone Receptor Antibody Application Details Handling Images back to top |
|
| Antigen | |
| Alternative Name | Growth Hormone R (GHR Antibody Abstract) |
| Background | Gene Symbol: GHR |
| Gene ID | 2690 |
| Pathways | NF-kappaB Signaling, JAK-STAT Signaling, Response to Growth Hormone Stimulus |
Application DetailsProduct Details anti-Growth Hormone Receptor Antibody Target Details Growth Hormone Receptor Handling Images back to top |
|
| Application Notes | Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50 - 1:200This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended. |
| Comment |
The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo. |
| Restrictions | For Research Use only |
HandlingProduct Details anti-Growth Hormone Receptor Antibody Target Details Growth Hormone Receptor Application Details Images back to top |
|
| Format | Liquid |
| Buffer |
PBS, pH 7.2, containing 40 % glycerol Buffer contains: 0.02 % Sodium Azide |
| Preservative | Sodium azide |
| Precaution of Use | This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Storage | 4 °C,-20 °C |
| Storage Comment | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
ImagesProduct Details anti-Growth Hormone Receptor Antibody Target Details Growth Hormone Receptor Application Details Handling back to top |
|
| Supplier Images |
Immunocytochemistry/Immunofluorescence: Growth Hormone R Antibody - Immunohistochemi...
Immunohistochemistry-Paraffin: Growth Hormone R Antibody - Staining of human liver s...
Immunohistochemistry-Paraffin: Growth Hormone R Antibody - Staining of human lymph n...
Immunohistochemistry-Paraffin: Growth Hormone R Antibody - Staining in human liver a...
|
