anti-Human Growth Hormone Receptor antibody for Immunocytochemistry

Recommended Growth Hormone Receptor Antibody (supplied by: Log in to see )

Growth Hormone Receptor (GHR) Antibodies
  • GHBP
  • AA986417
  • GHR/BP
  • GHR
  • ghr
  • ghr.a
  • zgc:162141
  • growth hormone receptor
  • growth hormone receptor L homeolog
  • growth hormone receptor a
  • GHR
  • Ghr
  • ghr.L
  • ghr
  • ghra
This Growth Hormone Receptor antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5077057
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1859006 ICC IHC WB Rabbit IgG AA 315-574 Log in to see Polyclonal 0
1 ABIN5077058 ICC IF Rabbit IgG Log in to see Polyclonal 0


Antigen Growth Hormone Receptor (GHR) Antibodies
Reactivity Human
(75), (44), (39), (16), (2), (1)
Host Rabbit
(78), (15), (2)
Conjugate This Growth Hormone Receptor antibody is un-conjugated
(4), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(59), (31), (14), (13), (11), (9), (5), (4), (2), (2), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-Growth Hormone Receptor Antibody

Target Details Growth Hormone Receptor Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQF
Isotype IgG
Plasmids, Primers & others

Target Details Growth Hormone Receptor

Product Details anti-Growth Hormone Receptor Antibody Application Details Handling Images back to top
Alternative Name Growth Hormone R (GHR Antibody Abstract)
Background Gene Symbol: GHR
Gene ID 2690
Pathways NF-kappaB Signaling, JAK-STAT Signaling, Response to Growth Hormone Stimulus

Application Details

Product Details anti-Growth Hormone Receptor Antibody Target Details Growth Hormone Receptor Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50 - 1:200This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-Growth Hormone Receptor Antibody Target Details Growth Hormone Receptor Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-Growth Hormone Receptor Antibody Target Details Growth Hormone Receptor Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Growth Hormone Receptor (GHR) antibody (ABIN5077057) Immunocytochemistry/Immunofluorescence: Growth Hormone R Antibody - Immunohistochemi...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Growth Hormone Receptor (GHR) antibody (ABIN5077057) Immunohistochemistry-Paraffin: Growth Hormone R Antibody - Staining of human liver s...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Growth Hormone Receptor (GHR) antibody (ABIN5077057) Immunohistochemistry-Paraffin: Growth Hormone R Antibody - Staining of human lymph n...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Growth Hormone Receptor (GHR) antibody (ABIN5077057) Immunohistochemistry-Paraffin: Growth Hormone R Antibody - Staining in human liver a...