anti-Human MAP3K14 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended MAP3K14 Antibody (supplied by: Log in to see )

Antigen
Mitogen-Activated Protein Kinase Kinase Kinase 14 (MAP3K14) Antibodies
  • FTDCR1B
  • HS
  • HSNIK
  • NIK
  • F23F1.4
  • F23F1_4
  • mitogen-activated protein kinase kinase kinase 14
  • Nik
  • aly
  • mitogen-activated protein kinase kinase kinase 14
  • MAP3K14
  • Map3k14
  • MAPKKK14
Reactivity
Human
114
62
42
7
4
3
2
2
2
1
1
1
Host
Rabbit
127
3
Clonality
Polyclonal
Conjugate
This MAP3K14 antibody is un-conjugated
8
7
7
5
5
5
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
112
52
42
20
17
16
13
6
2
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5950413
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN360384 EIA IHC (p) WB Rabbit Ig Fraction Middle Region Log in to see Polyclonal 3
1 ABIN392496 IHC (p) WB Rabbit Ig Fraction AA 119-148, Center Log in to see Polyclonal 0
1 ABIN724520 IF (p) IHC (p) WB Rabbit IgG AA 900-947 Log in to see Polyclonal 0
1 ABIN724529 IHC (p) WB HRP Rabbit IgG AA 900-947 Log in to see Polyclonal 0
1 ABIN724522 IHC (p) WB Biotin Rabbit IgG AA 900-947 Log in to see Polyclonal 0
1 ABIN1841001 IHC IHC (p) WB Rabbit AA 119-148 Log in to see Polyclonal 0
1 ABIN4339725 ICC IF IHC IHC (p) WB Rabbit AA 800-900, C-Term Log in to see Polyclonal 0
1 ABIN4339731 ICC IF IHC IHC (p) WB DyLight 680 Rabbit AA 800-900, C-Term Log in to see Polyclonal 0
1 ABIN4339739 ICC IF IHC IHC (p) WB Alexa Fluor 405 Rabbit AA 800-900, C-Term Log in to see Polyclonal 0
1 ABIN4339738 IHC IHC (p) WB HRP Rabbit AA 800-900, C-Term Log in to see Polyclonal 0
1 ABIN4339737 ICC IF IHC IHC (p) WB Biotin Rabbit AA 800-900, C-Term Log in to see Polyclonal 0
1 ABIN4339742 ICC IF IHC IHC (p) WB Alexa Fluor 700 Rabbit AA 800-900, C-Term Log in to see Polyclonal 0
1 ABIN4339727 ICC IF IHC IHC (p) WB DyLight 350 Rabbit AA 800-900, C-Term Log in to see Polyclonal 0
1 ABIN4339728 ICC IF IHC IHC (p) WB DyLight 405 Rabbit AA 800-900, C-Term Log in to see Polyclonal 0
1 ABIN4339732 ICC IF IHC IHC (p) WB DyLight 755 Rabbit AA 800-900, C-Term Log in to see Polyclonal 0
1 ABIN4339735 ICC IF IHC IHC (p) WB DyLight 650 Rabbit AA 800-900, C-Term Log in to see Polyclonal 0
1 ABIN4339740 ICC IF IHC IHC (p) WB Alexa Fluor 488 Rabbit AA 800-900, C-Term Log in to see Polyclonal 0
1 ABIN4339741 ICC IF IHC IHC (p) WB Alexa Fluor 647 Rabbit AA 800-900, C-Term Log in to see Polyclonal 0
1 ABIN4339730 ICC IF IHC IHC (p) WB DyLight 488 Rabbit AA 800-900, C-Term Log in to see Polyclonal 0
1 ABIN4339736 ICC IF IHC IHC (p) WB DyLight 550 Rabbit AA 800-900, C-Term Log in to see Polyclonal 0

General

Antigen Mitogen-Activated Protein Kinase Kinase Kinase 14 (MAP3K14) Antibodies
Reactivity Human
(114), (62), (42), (7), (4), (3), (2), (2), (2), (1), (1), (1)
Host Rabbit
(127), (3)
Clonality
Polyclonal
Conjugate This MAP3K14 antibody is un-conjugated
(8), (7), (7), (5), (5), (5), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(112), (52), (42), (20), (17), (16), (13), (6), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-MAP3K14 Antibody

Target Details MAP3K14 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SVYKLEAVEKSPVFCGKWEILNDVITKGTAKEGSEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNNVAHA
Plasmids, Primers & others

Target Details MAP3K14

Product Details anti-MAP3K14 Antibody Application Details Handling Images back to top
Antigen
Alternative Name NIK/MAP3K14 (MAP3K14 Antibody Abstract)
Background Gene Symbol: MAP3K14
Gene ID 9020
Pathways NF-kappaB Signaling, TCR Signaling

Application Details

Product Details anti-MAP3K14 Antibody Target Details MAP3K14 Handling Images back to top
Application Notes Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin, HIER  pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-MAP3K14 Antibody Target Details MAP3K14 Application Details Images back to top
Format Liquid
Buffer PBS (  pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-MAP3K14 Antibody Target Details MAP3K14 Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Mitogen-Activated Protein Kinase Kinase Kinase 14 (MAP3K14) antibody (ABIN5950413) Immunohistochemistry-Paraffin: MAP3K14 Antibody - Staining of human small intestine ...
Western Blotting (WB) image for anti-Mitogen-Activated Protein Kinase Kinase Kinase 14 (MAP3K14) antibody (ABIN5950413) Western Blot: MAP3K14 Antibody Lane 1: Marker 250, 130, 95, 72, 55, 36, 28, 17, 10 ...