anti-Human JAG2 antibody for Immunohistochemistry (Frozen Sections)

Recommended JAG2 Antibody (supplied by: Log in to see )

Jagged 2 (JAG2) Antibodies
  • D12Ggc2e
  • Serh
  • mJagged2-1
  • sm
  • HJ2
  • SER2
  • jag2
  • serB
  • zgc:152855
  • jagged 2
  • jagged 2b
  • JAG2
  • jag2
  • Jag2
  • jag2b
Human, Mouse (Murine)
This JAG2 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4327861
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.5 ABIN2475163 IHC (fro) FACS Hamster IgG Log in to see HMJ2-1 4
1 ABIN1820183 FACS IHC IHC (fro) Hamster IgG Log in to see HMJ2-1 0


Antigen Jagged 2 (JAG2) Antibodies
Reactivity Human, Mouse (Murine)
(83), (54), (30), (2), (2), (2)
Host Rabbit
(73), (20), (10), (8)
Conjugate This JAG2 antibody is un-conjugated
(6), (6), (6), (4), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(64), (41), (31), (21), (13), (9), (7), (4), (3), (2), (2), (2), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-JAG2 Antibody

Target Details JAG2 Application Details Handling References for anti-JAG2 antibody (ABIN4327861) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDENYYS
Isotype IgG
Plasmids, Primers & others

Target Details JAG2

Product Details anti-JAG2 Antibody Application Details Handling References for anti-JAG2 antibody (ABIN4327861) Images back to top
Alternative Name Jagged 2 (JAG2 Antibody Abstract)
Background Gene Symbol: JAG2
Gene ID 3714
Pathways Notch Signaling, Sensory Perception of Sound

Application Details

Product Details anti-JAG2 Antibody Target Details JAG2 Handling References for anti-JAG2 antibody (ABIN4327861) Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50, Immunohistochemistry-FrozenImmunohistochemistry retrieval recommended: HIER pH 6. Use in Immunohistochemistry-Frozen reported in scientific literature (PMID 27183608).

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-JAG2 Antibody Target Details JAG2 Application Details References for anti-JAG2 antibody (ABIN4327861) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-JAG2 antibody (ABIN4327861)

Product Details anti-JAG2 Antibody Target Details JAG2 Application Details Handling Images back to top
Product cited in:

Ihara, Hirata, Serizawa, Suzuki, Sakitani, Kinoshita, Hayakawa, Nakagawa, Ijichi, Tateishi, Koike: "TGF-β Signaling in Dendritic Cells Governs Colonic Homeostasis by Controlling Epithelial Differentiation and the Luminal Microbiota." in: Journal of immunology (Baltimore, Md. : 1950), Vol. 196, Issue 11, pp. 4603-13, 2016 (Sample species: Mouse (Murine)). Further details: Immunohistochemistry (Frozen Sections)


Product Details anti-JAG2 Antibody Target Details JAG2 Application Details Handling References for anti-JAG2 antibody (ABIN4327861) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Jagged 2 (JAG2) antibody (ABIN4327861) Immunohistochemistry-Paraffin: Jagged 2 Antibody [NBP1-86337] - Staining of human kid...
Immunofluorescence (IF) image for anti-Jagged 2 (JAG2) antibody (ABIN4327861) Immunocytochemistry/Immunofluorescence: Jagged 2 Antibody [NBP1-86337] - Immunofluore...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Jagged 2 (JAG2) antibody (ABIN4327861) Immunohistochemistry-Paraffin: Jagged 2 Antibody - Staining of human placenta shows ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Jagged 2 (JAG2) antibody (ABIN4327861) Immunohistochemistry-Paraffin: Jagged 2 Antibody - Staining of human cerebellum show...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Jagged 2 (JAG2) antibody (ABIN4327861) Immunohistochemistry-Paraffin: Jagged 2 Antibody - Staining of human cervix, uterine...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Jagged 2 (JAG2) antibody (ABIN4327861) Immunohistochemistry-Paraffin: Jagged 2 Antibody - Staining of human placenta shows ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Jagged 2 (JAG2) antibody (ABIN4327861) Immunohistochemistry-Paraffin: Jagged 2 Antibody - Staining of human skeletal muscle...