anti-Dog (Canine) CHEK1 antibody for Western Blotting

Recommended CHEK1 Antibody (supplied by: Log in to see )

Antigen
Checkpoint Kinase 1 (CHEK1) Antibodies
  • An08g10320
  • AO090003000441
  • CHK1
  • chk1
  • C85740
  • Chk1
  • rad27
  • id:ibd2720
  • zgc:56093
  • CHEK1
  • checkpoint kinase 1
  • serine/threonine-protein kinase chk1
  • serine/threonine-protein kinase Chk1
  • CAMK/CAMKL/CHK1 protein kinase Chk1
  • checkpoint kinase 1 S homeolog
  • CHEK1
  • ANI_1_2436074
  • AOR_1_768154
  • PTRG_04183
  • SJAG_01680
  • PAAG_04978
  • MCYG_03290
  • VDBG_03742
  • chek1.S
  • Chek1
  • chek1
Reactivity
Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
513
211
179
14
13
10
10
10
7
5
5
5
4
2
1
1
Host
Rabbit
453
54
22
7
Clonality
Polyclonal
Conjugate
This CHEK1 antibody is un-conjugated
14
13
12
11
10
8
3
3
3
3
3
3
3
3
3
3
3
2
1
1
Application
Immunohistochemistry (IHC), Western Blotting (WB)
446
221
171
81
71
40
33
21
21
16
13
7
6
6
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN634171
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
19.808132 ABIN2779737 IHC WB Rabbit Middle Region Log in to see Polyclonal 1
7.808131 ABIN2779738 IHC WB Rabbit Middle Region Log in to see Polyclonal 1
7 ABIN214737 IHC IHC (p) WB Rabbit AA 192-241 Log in to see Polyclonal 0
4.808131 ABIN2791667 WB Rabbit Middle Region Log in to see Polyclonal 0
4.808131 ABIN2460510 IHC ELISA WB Rabbit Log in to see Polyclonal 0
4 ABIN467776 WB Rabbit AA 251-300 Log in to see Polyclonal 0
1 ABIN601007 IHC ELISA WB Rabbit IgG pSer317 Log in to see Polyclonal 0
1 ABIN594241 WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN601008 IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1977788 IP PLA WB Goat IgG AA 250-300 Log in to see Polyclonal 0
1 ABIN1977787 PLA WB Goat IgG AA 200-250 Log in to see Polyclonal 0
1 ABIN1977789 ICC IF IHC IHC (p) IP PLA WB Rabbit IgG AA 250-300 Log in to see Polyclonal 0

General

Antigen Checkpoint Kinase 1 (CHEK1) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
(513), (211), (179), (14), (13), (10), (10), (10), (7), (5), (5), (5), (4), (2), (1), (1)
Host Rabbit
(453), (54), (22), (7)
Clonality
Polyclonal
Conjugate This CHEK1 antibody is un-conjugated
(14), (13), (12), (11), (10), (8), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (1), (1)
Application Immunohistochemistry (IHC), Western Blotting (WB)
(446), (221), (171), (81), (71), (40), (33), (21), (21), (16), (13), (7), (6), (6)
Supplier Log in to see

Product Details anti-CHEK1 Antibody

Target Details CHEK1 Application Details Handling Images
Purification Affinity purified
Immunogen CHEK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLAL
Plasmids, Primers & others

Target Details CHEK1

Product Details anti-CHEK1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name CHEK1 (CHEK1 Antibody Abstract)
Background CHEK1 is required during normal S phase to avoid aberrantly increased initiation of DNA replication, thereby protecting against DNA breakage. Its expression is dispensable for somatic cell death and critical for sustaining G2 DNA damage checkpoint.
Molecular Weight 54 kDa (MW of target protein)
Pathways p53 Signaling, Apoptosis, Cell Division Cycle

Application Details

Product Details anti-CHEK1 Antibody Target Details CHEK1 Handling Images back to top
Application Notes WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Comment

CHEK1 Blocking Peptide, catalog no. 33R-10008, is also available for use as a blocking control in assays to test for specificity of this CHEK1 antibody

Restrictions For Research Use only

Handling

Product Details anti-CHEK1 Antibody Target Details CHEK1 Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHEK1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product Details anti-CHEK1 Antibody Target Details CHEK1 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Checkpoint Kinase 1 (CHEK1) antibody (ABIN634171) CHEK1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to s...
Western Blotting (WB) image for anti-Checkpoint Kinase 1 (CHEK1) antibody (ABIN634171) CHEK1 antibody used at 0.5 ug/ml to detect target protein.