anti-Human MAP4 antibody for Immunocytochemistry

Recommended MAP4 Antibody (supplied by: Log in to see )

Microtubule-Associated Protein 4 (MAP4) Antibodies
  • XMAP4
  • mtap4
  • AA407148
  • MAP-4
  • Mtap-4
  • Mtap4
  • microtubule associated protein 4
  • microtubule associated protein 4 L homeolog
  • microtubule-associated protein 4
  • MAP4
  • map4.L
  • Map4
This MAP4 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4332659
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1869085 ICC IHC WB Rabbit IgG AA 243-549 Log in to see Polyclonal 0
1 ABIN4332658 ICC IF IHC IHC (p) Rabbit IgG Log in to see Polyclonal 0
1 ABIN596435 ICC WB Rabbit C-Term Log in to see Polyclonal 0


Antigen Microtubule-Associated Protein 4 (MAP4) Antibodies
Reactivity Human
(55), (37), (35), (1)
Host Rabbit
(55), (4)
Conjugate This MAP4 antibody is un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(32), (22), (21), (16), (11), (11), (5), (4), (2), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-MAP4 Antibody

Target Details MAP4 Application Details Handling References for anti-MAP4 antibody (ABIN4332659) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EAPLAKDGVLTLANNVTPAKDVPPLSETEATPVPIKDMEIAQTQKGISEDSHLESLQDVGQSAAPTFMISPETVTGT
Isotype IgG

Target Details MAP4

Product Details anti-MAP4 Antibody Application Details Handling References for anti-MAP4 antibody (ABIN4332659) Images back to top
Alternative Name MAP4 (MAP4 Antibody Abstract)
Background Gene Symbol: MAP4
Gene ID 4134
Pathways p53 Signaling, Microtubule Dynamics

Application Details

Product Details anti-MAP4 Antibody Target Details MAP4 Handling References for anti-MAP4 antibody (ABIN4332659) Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-MAP4 Antibody Target Details MAP4 Application Details References for anti-MAP4 antibody (ABIN4332659) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-MAP4 antibody (ABIN4332659)

Product Details anti-MAP4 Antibody Target Details MAP4 Application Details Handling Images back to top
Product cited in:

Stadler, Rexhepaj, Singan, Murphy, Pepperkok, Uhlén, Simpson, Lundberg: "Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells." in: Nature methods, Vol. 10, Issue 4, pp. 315-23, 2013


Product Details anti-MAP4 Antibody Target Details MAP4 Application Details Handling References for anti-MAP4 antibody (ABIN4332659) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Microtubule-Associated Protein 4 (MAP4) antibody (ABIN4332659) Immunohistochemistry-Paraffin: MAP4 Antibody [NBP1-89483] - Staining of human heart m...
Immunofluorescence (IF) image for anti-Microtubule-Associated Protein 4 (MAP4) antibody (ABIN4332659) Immunocytochemistry/Immunofluorescence: MAP4 Antibody [NBP1-89483] - Staining of huma...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Microtubule-Associated Protein 4 (MAP4) antibody (ABIN4332659) Immunohistochemistry-Paraffin: MAP4 Antibody [NBP1-89483] - Staining of human cerebra...
Western Blotting (WB) image for anti-Microtubule-Associated Protein 4 (MAP4) antibody (ABIN4332659) Western Blot: MAP4 Antibody [NBP1-89483] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Microtubule-Associated Protein 4 (MAP4) antibody (ABIN4332659) Immunohistochemistry-Paraffin: MAP4 Antibody - Staining of human heart muscle shows ...