Get this product for free
Submit your validation data for this product and get a full refund. I want to validate this productRelevance Score | ABIN | Application | Conjugate | Host | Isotype | Epitope | Supplier | Clonality | References | Details |
---|---|---|---|---|---|---|---|---|---|---|
1 | ABIN260230 | ICC IF IHC (p) IP IHC ELISA WB | Mouse | IgG1 | Log in to see | 3A9 | 1 | |||
1 | ABIN181090 | EIA IF IHC (p) IP WB | Mouse | IgG1 | Log in to see | 3A9 | 1 | |||
1 | ABIN968616 | IF WB | Mouse | IgG1 | AA 375-580 | Log in to see | 49-AIP1 | 2 | ||
1 | ABIN968617 | IF WB | Mouse | IgG1 | AA 375-580 | Log in to see | 49-AIP1 | 2 | ||
1 | ABIN1874065 | IF IP WB | Rabbit | IgG | Log in to see | Polyclonal | 0 | |||
1 | ABIN4279372 | ELISA ICC IF IHC IHC (p) IP WB | Mouse | IgG1 | Log in to see | 3A9 | 0 | |||
1 | ABIN5664007 | IF WB | Rabbit | IgG | Log in to see | Polyclonal | 0 | |||
1 | ABIN609143 | IF IHC (p) IP ELISA WB | Mouse | IgG1 | Log in to see | 0 | ||||
1 | ABIN2626626 | IF IHC (p) IP WB | Rabbit | IgG | AA 818-868 | Log in to see | Polyclonal | 0 | ||
1 | ABIN4279378 | ELISA ICC IF IHC IHC (p) WB | DyLight 405 | Mouse | IgG1 | Log in to see | 3A9 | 0 | ||
1 | ABIN4279377 | ELISA ICC IF IHC IHC (p) WB | DyLight 350 | Mouse | IgG1 | Log in to see | 3A9 | 0 | ||
1 | ABIN4279380 | ELISA ICC IF IHC IHC (p) IP WB | PerCP | Mouse | IgG1 | Log in to see | 3A9 | 0 | ||
1 | ABIN4279383 | ELISA ICC IF IHC IHC (p) WB | DyLight 488 | Mouse | IgG1 | Log in to see | 3A9 | 0 | ||
1 | ABIN4279386 | ELISA ICC IF IHC IHC (p) WB | Alexa Fluor 405 | Mouse | IgG1 | Log in to see | 3A9 | 0 | ||
1 | ABIN4279387 | ELISA ICC IF IHC IHC (p) WB | Alexa Fluor 488 | Mouse | IgG1 | Log in to see | 3A9 | 0 | ||
1 | ABIN4279388 | ELISA ICC IF IHC IHC (p) WB | Alexa Fluor 647 | Mouse | IgG1 | Log in to see | 3A9 | 0 | ||
1 | ABIN4279389 | ELISA ICC IF IHC IHC (p) WB | Alexa Fluor 700 | Mouse | IgG1 | Log in to see | 3A9 | 0 | ||
1 | ABIN4279382 | ELISA ICC IF IHC IHC (p) WB | DyLight 755 | Mouse | IgG1 | Log in to see | 3A9 | 0 | ||
1 | ABIN4279385 | ELISA ICC IF IHC IHC (p) WB | DyLight 680 | Mouse | IgG1 | Log in to see | 3A9 | 0 | ||
1 | ABIN4279375 | ICC IF IHC IHC (p) WB | Rabbit | IgG | Log in to see | Polyclonal | 0 |
General |
|
---|---|
Antigen | Programmed Cell Death 6 Interacting Protein (PDCD6IP) Antibodies |
Reactivity | Human, Mouse (Murine), Rat (Rattus) Alternatives |
Host | Rabbit Alternatives |
Clonality | |
Conjugate | This PDCD6IP antibody is un-conjugated Alternatives |
Application |
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Alternatives
|
Supplier | Log in to see |
Product Details anti-PDCD6IP AntibodyTarget Details PDCD6IP Application Details Handling Images |
|
Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Purification | Immunogen affinity purified |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:VPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDND |
Isotype | IgG |
Target Details PDCD6IPProduct Details anti-PDCD6IP Antibody Application Details Handling Images back to top |
|
Antigen | |
Alternative Name | Alix (PDCD6IP Antibody Abstract) |
Background | Gene Symbol: PDCD6IP |
Gene ID | 10015 |
Pathways | p53 Signaling, EGFR Signaling Pathway, Sensory Perception of Sound, Cellular Response to Molecule of Bacterial Origin, Tube Formation |
Application DetailsProduct Details anti-PDCD6IP Antibody Target Details PDCD6IP Handling Images back to top |
|
Application Notes | Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100. |
Comment |
The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo. |
Restrictions | For Research Use only |
HandlingProduct Details anti-PDCD6IP Antibody Target Details PDCD6IP Application Details Images back to top |
|
Format | Liquid |
Buffer |
PBS ( pH 7.2) and 40 % Glycerol Buffer contains: 0.02 % Sodium Azide |
Preservative | Sodium azide |
Precaution of Use | This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Storage | 4 °C,-20 °C |
Storage Comment | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
ImagesProduct Details anti-PDCD6IP Antibody Target Details PDCD6IP Application Details Handling back to top |
|
Supplier Images |
|