anti-Human PIDD antibody for Immunocytochemistry

Recommended PIDD Antibody (supplied by: Log in to see )

P53-Induced Death Domain Protein (PIDD) Antibodies
  • 1200011D09Rik
  • AU042446
  • Pidd
  • LRDD
  • Lrdd
  • p53 induced death domain protein 1
  • p53-induced death domain protein 1
  • Pidd1
  • PIDD1
This PIDD antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5077892
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN5013870 ICC IHC WB Rabbit IgG AA 694-885 Log in to see Polyclonal 0


Antigen P53-Induced Death Domain Protein (PIDD) Antibodies
Reactivity Human
(46), (38), (28), (2), (1), (1), (1), (1)
Host Rabbit
(47), (6)
Conjugate This PIDD antibody is un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(37), (20), (13), (10), (6), (5), (3), (1), (1)
Supplier Log in to see

Product Details anti-PIDD Antibody

Target Details PIDD Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SFPVTPRGCSVTLACGVRLQFPAGATATPITIRYRLLLPEPGLVPLGPHDALLSHVLELQPHGVAFQQDVGLWLLFTPPQARRCREVVV
Isotype IgG
Plasmids, Primers & others

Target Details PIDD

Product Details anti-PIDD Antibody Application Details Handling Images back to top
Alternative Name LRDD (PIDD Antibody Abstract)
Background Gene Symbol: PIDD
Gene ID 55367
Pathways p53 Signaling, Caspase Cascade in Apoptosis, Positive Regulation of Endopeptidase Activity

Application Details

Product Details anti-PIDD Antibody Target Details PIDD Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-PIDD Antibody Target Details PIDD Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-PIDD Antibody Target Details PIDD Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-P53-Induced Death Domain Protein (PIDD) antibody (ABIN5077892) Immunocytochemistry/Immunofluorescence: LRDD Antibody - Staining of human cell line ...