anti-Mouse (Murine) PPP1R13B antibody for Western Blotting

Recommended PPP1R13B Antibody (supplied by: Log in to see )

Protein Phosphatase 1, Regulatory Subunit 13B (PPP1R13B) Antibodies
  • ASPP1
  • p53BP2-like
  • p85
  • AI449786
  • AW545810
  • Tp53bp2
  • Trp53bp2
  • protein phosphatase 1 regulatory subunit 13B
  • protein phosphatase 1, regulatory subunit 13B
  • protein phosphatase 1 regulatory subunit 13B L homeolog
  • protein phosphatase 1, regulatory subunit 13Bb
  • protein phosphatase 1, regulatory (inhibitor) subunit 13B
  • PPP1R13B
  • Ppp1r13b
  • ppp1r13b.L
  • ppp1r13bb
  • ppp1r13b
Human, Mouse (Murine), Rat (Rattus)
This PPP1R13B antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN634596
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
7.730314 ABIN2783179 WB Rabbit Middle Region Log in to see Polyclonal 1
5.5 ABIN674379 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 1
4.730314 ABIN2706858 WB Rabbit Center Log in to see Polyclonal 0
4.730314 ABIN2706857 WB Rabbit Center Log in to see Polyclonal 0
4.730314 ABIN6259064 ELISA WB Rabbit IgG Log in to see Polyclonal 0
4.730314 ABIN2459151 ELISA WB Rabbit Log in to see Polyclonal 0
4.730314 ABIN5926867 WB Rabbit Log in to see Polyclonal 0
4.730314 ABIN2972021 WB Rabbit Center Log in to see Polyclonal 0
4 ABIN463611 WB Rabbit IgG AA 900-949 Log in to see Polyclonal 0
1 ABIN5551815 EIA WB Rabbit IgG Internal Region Log in to see Polyclonal 0
1 ABIN674388 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal 0
1 ABIN674381 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal 0
1 ABIN2576604 WB Rabbit Internal Region Log in to see Polyclonal 0
1 ABIN2743751 WB Rabbit Internal Region Log in to see Polyclonal 0
1 ABIN6710721 WB Rabbit Log in to see Polyclonal 0
1 ABIN6710787 WB Rabbit Log in to see Polyclonal 0
1 ABIN6293292 WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2971243 WB Rabbit Center Log in to see Polyclonal 0
-0.3008734 ABIN4281914 ICC IF IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal 0


Antigen Protein Phosphatase 1, Regulatory Subunit 13B (PPP1R13B) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(68), (33), (29), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Host Rabbit
(68), (1)
Conjugate This PPP1R13B antibody is un-conjugated
(4), (4), (4), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(49), (30), (13), (6), (5), (4), (2), (1), (1)
Supplier Log in to see

Product Details anti-PPP1R13B Antibody

Target Details PPP1R13B Application Details Handling Images
Purification Affinity purified
Immunogen PPP1 R11 antibody was raised using a synthetic peptide corresponding to a region with amino acids EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNA
Plasmids, Primers & others

Target Details PPP1R13B

Product Details anti-PPP1R13B Antibody Application Details Handling Images back to top
Alternative Name PPP1R13B (PPP1R13B Antibody Abstract)
Background PPP1R13B is a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. ASPP proteins are required for the induction of apoptosis by p53-family proteins. They promote DNA binding and transactivation of p53-family proteins on the promoters of proapoptotic genes. Expression of this gene is regulated by the E2F transcription factor.
Molecular Weight 119 kDa (MW of target protein)
Pathways p53 Signaling

Application Details

Product Details anti-PPP1R13B Antibody Target Details PPP1R13B Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

PPP1R13B Blocking Peptide, catalog no. 33R-2400, is also available for use as a blocking control in assays to test for specificity of this PPP1R13B antibody

Restrictions For Research Use only


Product Details anti-PPP1R13B Antibody Target Details PPP1R13B Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 10 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Product Details anti-PPP1R13B Antibody Target Details PPP1R13B Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Protein Phosphatase 1, Regulatory Subunit 13B (PPP1R13B) antibody (ABIN634596) PPP1R13B antibody used at 1 ug/ml to detect target protein.