anti-Human Butyrylcholinesterase antibody for Immunohistochemistry

Recommended Butyrylcholinesterase Antibody (supplied by: Log in to see )

Antigen
Butyrylcholinesterase (BCHE) Antibodies
  • che
  • che1
  • bche
  • cholinesterase
  • CHE1
  • CHE2
  • E1
  • C730038G20Rik
  • butyrylcholinesterase L homeolog
  • butyrylcholinesterase
  • bche.L
  • bche
  • BCHE
  • Bche
Reactivity
Human
114
41
35
16
4
2
2
2
1
1
1
1
1
Host
Rabbit
85
46
Clonality
Polyclonal
Conjugate
This Butyrylcholinesterase antibody is un-conjugated
13
8
7
4
4
3
3
3
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
67
48
36
16
14
12
4
4
4
3
3
3
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4285607
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.907254 ABIN1859232 ICC IHC WB Rabbit IgG AA 29-150 Log in to see Polyclonal 0
8.907254 ABIN630462 IHC WB Rabbit N-Term Log in to see Polyclonal 0
1 ABIN2781762 IHC WB Rabbit N-Term Log in to see Polyclonal 1
1 ABIN3183893 ELISA IHC WB Rabbit IgG N-Term Log in to see Polyclonal 0
1 ABIN2462791 IHC ELISA WB Rabbit Log in to see Polyclonal 0
1 ABIN1826539 IHC ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN4285606 IHC IHC (p) WB Rabbit N-Term Log in to see Polyclonal 0
1 ABIN2888230 IF IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN5697143 ELISA IF IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2989724 IF/ICC IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1732246 IF IHC (p) IHC ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2901319 ELISA IF/ICC IHC WB Rabbit AA 29-150 Log in to see Polyclonal 0
1 ABIN2764806 IHC (p) IHC ELISA WB Rabbit Log in to see Polyclonal 0

General

Antigen Butyrylcholinesterase (BCHE) Antibodies
Reactivity Human
(114), (41), (35), (16), (4), (2), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(85), (46)
Clonality
Polyclonal
Conjugate This Butyrylcholinesterase antibody is un-conjugated
(13), (8), (7), (4), (4), (3), (3), (3), (3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(67), (48), (36), (16), (14), (12), (4), (4), (4), (3), (3), (3), (2), (2), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-Butyrylcholinesterase Antibody

Target Details Butyrylcholinesterase Application Details Handling References for anti-Butyrylcholinesterase antibody (ABIN4285607) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVD
Isotype IgG

Target Details Butyrylcholinesterase

Product Details anti-Butyrylcholinesterase Antibody Application Details Handling References for anti-Butyrylcholinesterase antibody (ABIN4285607) Images back to top
Antigen
Alternative Name Butyrylcholinesterase/BCHE (BCHE Antibody Abstract)
Background Gene Symbol: BCHE
Gene ID 590
Pathways Peptide Hormone Metabolism

Application Details

Product Details anti-Butyrylcholinesterase Antibody Target Details Butyrylcholinesterase Handling References for anti-Butyrylcholinesterase antibody (ABIN4285607) Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Butyrylcholinesterase Antibody Target Details Butyrylcholinesterase Application Details References for anti-Butyrylcholinesterase antibody (ABIN4285607) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-Butyrylcholinesterase antibody (ABIN4285607)

Product Details anti-Butyrylcholinesterase Antibody Target Details Butyrylcholinesterase Application Details Handling Images back to top
Product cited in:

Kato, Nicholson, Neiman, Rantalainen, Holmes, Barrett, Uhlén, Nilsson, Spector, Schwenk: "Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model." in: Proteome science, Vol. 9, pp. 73, 2011

Images

Product Details anti-Butyrylcholinesterase Antibody Target Details Butyrylcholinesterase Application Details Handling References for anti-Butyrylcholinesterase antibody (ABIN4285607) back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Butyrylcholinesterase (BCHE) antibody (ABIN4285607) Immunohistochemistry: Butyrylcholinesterase/BCHE Antibody [NBP1-85633] - Human skelet...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Butyrylcholinesterase (BCHE) antibody (ABIN4285607) Immunohistochemistry-Paraffin: Butyrylcholinesterase/BCHE Antibody - Staining of hum...