anti-Mouse (Murine) Butyrylcholinesterase antibody for Immunohistochemistry

Recommended Butyrylcholinesterase Antibody (supplied by: Log in to see )

Butyrylcholinesterase (BCHE) Antibodies
  • che
  • che1
  • bche
  • cholinesterase
  • CHE1
  • CHE2
  • E1
  • C730038G20Rik
  • butyrylcholinesterase L homeolog
  • butyrylcholinesterase
  • bche.L
  • bche
  • BCHE
  • Bche
Human, Mouse (Murine), Dog (Canine)
This Butyrylcholinesterase antibody is un-conjugated
Immunohistochemistry (IHC), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN630462
$ 437.50
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
16.252602 ABIN3183893 ELISA IHC WB Rabbit IgG N-Term Log in to see Polyclonal 0
14.62995 ABIN2781762 IHC WB Rabbit N-Term Log in to see Polyclonal 1
7 ABIN205033 IHC IHC (p) WB Rabbit IgG AA 151-200 Log in to see Polyclonal 0
7 ABIN2989724 IF/ICC IHC WB Rabbit IgG Log in to see Polyclonal 0
4 ABIN2462791 IHC ELISA WB Rabbit Log in to see Polyclonal 0
1 ABIN2888230 IF IHC WB Rabbit IgG Log in to see Polyclonal 0


Antigen Butyrylcholinesterase (BCHE) Antibodies
Epitope N-Term
(15), (12), (6), (5), (4), (4), (4), (4), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Dog (Canine)
(125), (47), (44), (15), (4), (2), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(97), (47)
Conjugate This Butyrylcholinesterase antibody is un-conjugated
(13), (9), (8), (4), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Western Blotting (WB)
(75), (54), (39), (20), (17), (12), (9), (8), (4), (3), (2), (2), (2), (2), (1)
Supplier Log in to see

Product Details anti-Butyrylcholinesterase Antibody

Target Details Butyrylcholinesterase Application Details Handling Images
Specificity BCHE antibody was raised against the N terminal of BCHE
Purification Purified
Immunogen BCHE antibody was raised using the N terminal of BCHE corresponding to a region with amino acids SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ
Plasmids, Primers & others

Target Details Butyrylcholinesterase

Product Details anti-Butyrylcholinesterase Antibody Application Details Handling Images back to top
Alternative Name BCHE (BCHE Antibody Abstract)
Background Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage.
Molecular Weight 68 kDa (MW of target protein)
Pathways Peptide Hormone Metabolism

Application Details

Product Details anti-Butyrylcholinesterase Antibody Target Details Butyrylcholinesterase Handling Images back to top
Application Notes WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

BCHE Blocking Peptide, catalog no. 33R-8821, is also available for use as a blocking control in assays to test for specificity of this BCHE antibody

Restrictions For Research Use only


Product Details anti-Butyrylcholinesterase Antibody Target Details Butyrylcholinesterase Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCHE antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Product Details anti-Butyrylcholinesterase Antibody Target Details Butyrylcholinesterase Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Butyrylcholinesterase (BCHE) (N-Term) antibody (ABIN630462) BCHE antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to st...
Western Blotting (WB) image for anti-Butyrylcholinesterase (BCHE) (N-Term) antibody (ABIN630462) BCHE antibody used at 1.25 ug/ml to detect target protein.