anti-Human Cathepsin Z antibody for Immunofluorescence

Recommended Cathepsin Z Antibody (supplied by: Log in to see )

Cathepsin Z (CTSZ) Antibodies
  • wu:fj81f10
  • zgc:103420
  • CTSZ
  • CTSX
  • AI787083
  • AU019819
  • D2Wsu143e
  • CATX
  • CathePsin Z
  • cathepsin Z
  • cathepsin Z S homeolog
  • papain family cysteine protease
  • cpz-1
  • cpz-2
  • CTSZ
  • ctsz
  • ctsz.S
  • TTHERM_00102779
  • NAEGRDRAFT_78125
  • Ctsz
This Cathepsin Z antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4288282
Contact our Customer Service for availability and price in your country.


Antigen Cathepsin Z (CTSZ) Antibodies
Reactivity Human
(99), (32), (24), (3), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(65), (41)
Conjugate This Cathepsin Z antibody is un-conjugated
(6), (6), (5), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes), Western Blotting (WB)
(81), (47), (18), (13), (6), (4), (4), (3), (2)
Supplier Log in to see

Product Details anti-Cathepsin Z Antibody

Target Details Cathepsin Z Application Details Handling Images
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: PDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQD
Plasmids, Primers & others

Target Details Cathepsin Z

Product Details anti-Cathepsin Z Antibody Application Details Handling Images back to top
Alternative Name Cathepsin Z (CTSZ Antibody Abstract)
Background Gene Symbol: CTSZ
Gene ID 1522
UniProt Q9UBR2
Pathways Peptide Hormone Metabolism, Regulation of Systemic Arterial Blood Pressure by Hormones

Application Details

Product Details anti-Cathepsin Z Antibody Target Details Cathepsin Z Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Simple Western 1:10, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200In Simple Western only 10-15 μL of the recommended dilution is used per data point.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-Cathepsin Z Antibody Target Details Cathepsin Z Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-Cathepsin Z Antibody Target Details Cathepsin Z Application Details Handling back to top
Supplier Images
Simple Western (SimWes) image for anti-Cathepsin Z (CTSZ) antibody (ABIN4288282) Simple Western: Cathepsin Z Antibody [NBP2-38614] - Simple Western lane view shows a ...
Simple Western (SimWes) image for anti-Cathepsin Z (CTSZ) antibody (ABIN4288282) Simple Western: Cathepsin Z Antibody [NBP2-38614] - Electropherogram image of the cor...
Western Blotting (WB) image for anti-Cathepsin Z (CTSZ) antibody (ABIN4288282) Western Blot: Cathepsin Z Antibody [NBP2-38614] - Lane 1: Marker [kDa] 250, 130, 100,...
Immunohistochemistry (IHC) image for anti-Cathepsin Z (CTSZ) antibody (ABIN4288282) Immunohistochemistry: Cathepsin Z Antibody [NBP2-38614] - Staining of human small int...
Immunofluorescence (IF) image for anti-Cathepsin Z (CTSZ) antibody (ABIN4288282) Immunocytochemistry/Immunofluorescence: Cathepsin Z Antibody [NBP2-38614] - Immunoflu...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Cathepsin Z (CTSZ) antibody (ABIN4288282) Immunohistochemistry-Paraffin: Cathepsin Z Antibody - Staining of human small intest...