anti-Human DPP4 antibody for Immunocytochemistry

Recommended DPP4 Antibody (supplied by: Log in to see )

Dipeptidyl-Peptidase 4 (DPP4) Antibodies
  • ADCP2
  • CD26
  • TP103
  • MGC81966
  • MOP9.8
  • MOP9_8
  • DPP4
  • si:ch73-2d23.3
  • Cd26
  • Dpp-4
  • THAM
  • dipeptidyl peptidase 4
  • dipeptidyl-peptidase 4 S homeolog
  • prolyl oligopeptidase family protein
  • dipeptidyl-peptidase 4
  • dipeptidylpeptidase 4
  • DPP4
  • dpp4.S
  • AT5G24260
  • dpp4
  • Dpp4
Human, Mouse (Murine), Rat (Rattus)
This DPP4 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4306062
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1173872 ICC IHC WB Rabbit IgG AA 484-728 Log in to see Polyclonal 0
1 ABIN2486969 ICC IHC WB Goat IgG Log in to see Polyclonal 0
1 ABIN1858662 ICC IHC (fro) IHC (p) ELISA WB Mouse IgG AA 484-728 Log in to see 0
1 ABIN5566986 FACS ICC IF IHC PE Rabbit AA 39-766 Log in to see Polyclonal 0
1 ABIN5566982 FACS ICC IF IHC APC Rabbit AA 39-766 Log in to see Polyclonal 0
1 ABIN4306068 FACS ICC IF IHC IHC (p) WB Mouse IgG1 Log in to see 11D7 0
1 ABIN4306069 FACS ICC IF IHC IP Mouse IgG2b kappa Log in to see 236-3 0
1 ABIN2467804 ICC Chicken AA 547-610 Log in to see Polyclonal 0
1 ABIN4959585 ICC IHC Alexa Fluor 488 Goat IgG Log in to see Polyclonal 0
1 ABIN2598994 ICC IHC WB Goat IgG Log in to see Polyclonal 0
1 ABIN5566984 FACS ICC IF IHC FITC Rabbit AA 39-766 Log in to see Polyclonal 0
1 ABIN4959586 ICC IHC SimWes WB Goat IgG Log in to see Polyclonal 0


Antigen Dipeptidyl-Peptidase 4 (DPP4) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(446), (148), (124), (29), (19), (14), (9), (7), (6), (5), (5), (5), (4), (3), (2), (2), (2), (1), (1), (1), (1)
Host Chicken
(358), (150), (97), (22), (4)
Conjugate This DPP4 antibody is un-conjugated
(61), (59), (44), (29), (16), (16), (13), (13), (11), (10), (9), (9), (9), (9), (9), (6), (6), (5), (5), (5), (5), (5), (4), (4), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
(419), (152), (125), (105), (95), (65), (45), (38), (15), (13), (13), (10), (8), (7), (4), (4), (4), (3), (2), (1), (1)
Supplier Log in to see

Product Details anti-DPP4 Antibody

Target Details DPP4 Application Details Handling Images
Specificity CD26
Purification Immunogen affinity purified
Immunogen Synthetic peptide: YAGPCSQKADTVFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTFEVEDQIEAA, corresponding to amino acids 547-610 of Human CD26.

Target Details DPP4

Product Details anti-DPP4 Antibody Application Details Handling Images back to top
Alternative Name DPPIV/CD26 (DPP4 Antibody Abstract)
Background Gene Symbol: DPP4
Gene ID 1803
Pathways Peptide Hormone Metabolism, Regulation of Leukocyte Mediated Immunity

Application Details

Product Details anti-DPP4 Antibody Target Details DPP4 Handling Images back to top
Application Notes Western Blot 1:100-1:2000, Immunocytochemistry/Immunofluorescence 1:10-1:500

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-DPP4 Antibody Target Details DPP4 Application Details Images back to top
Format Liquid
Concentration 1.0 mg/mL
Buffer PBS
Buffer contains: No Preservative
Preservative Without preservative
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-DPP4 Antibody Target Details DPP4 Application Details Handling back to top
Supplier Images
Immunocytochemistry (ICC) image for anti-Dipeptidyl-Peptidase 4 (DPP4) antibody (ABIN4306062) Immunocytochemistry: DPPIV/CD26 Antibody [ABIN43060628] - CD26 Antibody [ABIN43060628...