anti-Mouse (Murine) Exocyst Complex Component 3 antibody for Western Blotting

Recommended Exocyst Complex Component 3 Antibody (supplied by: Log in to see )

Antigen
Exocyst Complex Component 3 (EXOC3) Antibodies
  • CG5341
  • Dmel\\CG5341
  • Dsec6
  • Sec6
  • Sec6p
  • dsec6
  • sec 6
  • F14O23.20
  • F14O23_20
  • sec6l1
  • fi26g09
  • wu:fi26g09
  • wu:fi34a09
  • wu:fj62h05
  • wu:fk66f08
  • zgc:55709
  • SEC6L1
  • SEC6
  • 2810050O03Rik
  • E430013E20Rik
  • Sec6l1
  • rSec6
  • Secretory 6
  • SEC6
  • exocyst complex component 3
  • Exocyst complex component 3
  • Sec6
  • SEC6
  • EXOC3
  • exoc3
  • Exoc3
  • sec-6
Epitope
Middle Region
3
2
2
2
2
1
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
38
25
24
4
4
3
3
3
2
2
2
2
2
2
1
Host
Rabbit
33
8
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
29
13
12
9
8
4
3
3
2
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN631429
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
7.808835 ABIN6264960 IHC WB Rabbit IgG Log in to see Polyclonal 0
7 ABIN364382 IHC IHC (p) WB Mouse IgG2a Log in to see 9H5 0
4.808835 ABIN2784880 IHC WB Rabbit Middle Region Log in to see Polyclonal 1
4.808835 ABIN2459523 ELISA WB Rabbit Log in to see Polyclonal 0
4 ABIN463754 WB Rabbit IgG AA 252-301 Log in to see Polyclonal 0
1 ABIN1408922 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal 0
1 ABIN1391029 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal 0
1 ABIN1387476 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN5697650 ELISA IF IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN5865349 ELISA IF/ICC IHC WB Rabbit IgG Log in to see Polyclonal 0
-1.7530183 ABIN4352419 IHC IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal 0
-11.561853 ABIN4352417 ICC IF IHC IHC (p) WB Mouse IgG2a Log in to see 9H5 0

General

Antigen Exocyst Complex Component 3 (EXOC3) Antibodies
Epitope Middle Region
(3), (2), (2), (2), (2), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(38), (25), (24), (4), (4), (3), (3), (3), (2), (2), (2), (2), (2), (2), (1)
Host Rabbit
(33), (8)
Clonality
Polyclonal
Conjugate Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(29), (13), (12), (9), (8), (4), (3), (3), (2)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Specificity EXOC3 antibody was raised against the middle region of EXOC3
Purification Affinity purified
Immunogen EXOC3 antibody was raised using the middle region of EXOC3 corresponding to a region with amino acids LERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCF

Target Details

Product details Application Details Handling Images back to top
Antigen
Alternative Name EXOC3 (EXOC3 Antibody Abstract)
Background EXOC3 is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery.
Molecular Weight 85 kDa (MW of target protein)
Pathways Peptide Hormone Metabolism, Synaptic Vesicle Exocytosis

Application Details

Product details Target Details Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

EXOC3 Blocking Peptide, catalog no. 33R-4927, is also available for use as a blocking control in assays to test for specificity of this EXOC3 antibody

Restrictions For Research Use only

Handling

Product details Target Details Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC3 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product details Target Details Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Exocyst Complex Component 3 (EXOC3) (Middle Region) antibody (ABIN631429) EXOC3 antibody used at 1 ug/ml to detect target protein.