anti-Rat (Rattus) Exocyst Complex Component 7 antibody for Immunofluorescence

Recommended Exocyst Complex Component 7 Antibody (supplied by: Log in to see )

Antigen
Exocyst Complex Component 7 (EXOC7) Antibodies
  • CG7127
  • Dmel\\CG7127
  • Exo70
  • Exo70p
  • zgc:56575
  • ATEXO70H5
  • T8O18.7
  • T8O18_7
  • exocyst subunit exo70 family protein H5
  • ATEXO70H8
  • T8O18.6
  • T8O18_6
  • exocyst subunit exo70 family protein H8
  • ATEXO70H2
  • F12L6.4
  • F12L6_4
  • exocyst subunit exo70 family protein H2
  • ATEXO70H4
  • exocyst subunit exo70 family protein H4
  • ATEXO70H3
  • exocyst subunit exo70 family protein H3
  • ATEXO70G1
  • F3L17.110
  • F3L17_110
  • exocyst subunit exo70 family protein G1
  • ATEXO70C1
  • T19L5.110
  • T19L5_110
  • exocyst subunit exo70 family protein C1
  • ATEXO70C2
  • MAC12.17
  • MAC12_17
  • exocyst subunit exo70 family protein C2
  • ATEXO70F1
  • MXI22.10
  • MXI22_10
  • exocyst subunit exo70 family protein F1
  • ATEXO70A3
  • K24M7.8
  • K24M7_8
  • exocyst subunit exo70 family protein A3
  • ATEXO70E2
  • MAF19.1
  • MAF19_1
  • exocyst subunit exo70 family protein E2
  • ATEXO70B2
  • F10K1.28
  • F10K1_28
  • exocyst subunit exo70 family protein B2
  • ATEXO70G2
  • F19C24.13
  • F19C24_13
  • exocyst subunit exo70 family protein G2
  • ATEXO70D2
  • F15I1.17
  • F15I1_17
  • exocyst subunit exo70 family protein D2
  • exoc7
  • EXOC7
  • DDBDRAFT_0217074
  • DDBDRAFT_0233927
  • DDB_0217074
  • DDB_0233927
  • DKFZp459C0924
  • 2-5-3p
  • EX070
  • EXO70
  • EXOC1
  • YJL085W
  • sec70
  • Exocyst 70
  • exocyst complex component 7
  • exocyst subunit exo70 family protein H5
  • exocyst subunit exo70 family protein H8
  • exocyst subunit exo70 family protein H2
  • exocyst subunit exo70 family protein H4
  • exocyst subunit exo70 family protein H3
  • exocyst subunit exo70 family protein G1
  • exocyst subunit exo70 family protein C1
  • exocyst subunit exo70 family protein C2
  • exocyst subunit exo70 family protein F1
  • exocyst subunit exo70 family protein A3
  • exocyst subunit exo70 family protein E2
  • exocyst subunit exo70 family protein B2
  • exocyst subunit exo70 family protein G2
  • exocyst subunit exo70 family protein D2
  • exocyst complex subunit 7
  • exocyst complex component 7 L homeolog
  • Exo70
  • exoc7
  • EXOC7
  • EXO70H5
  • EXO70H8
  • EXO70H2
  • EXO70H4
  • EXO70H3
  • EXO70G1
  • EXO70C1
  • EXO70C2
  • EXO70F1
  • EXO70A3
  • EXO70E2
  • EXO70B2
  • EXO70G2
  • EXO70D2
  • exoc7.L
  • Exoc7
Reactivity
Human, Mouse (Murine), Rat (Rattus)
47
10
10
4
4
2
2
1
1
1
1
Host
Rabbit
21
20
6
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
44
25
22
9
6
5
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4309743
Contact our Customer Service for availability and price in your country.

General

Antigen Exocyst Complex Component 7 (EXOC7) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(47), (10), (10), (4), (4), (2), (2), (1), (1), (1), (1)
Host Rabbit
(21), (20), (6)
Clonality
Polyclonal
Conjugate Un-conjugated
(1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(44), (25), (22), (9), (6), (5), (2), (1), (1)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:DDMLDVETDAYIHCVSAFVKLAQSEYQLLADIIPEHHQKKTFDSLIQDALDGLMLEGENIVSAARKAIVRHDFSTVLTVFPILRHLKQTKPEFDQVLQGTAASTKNKLPGLITSMETIGAKA
Isotype IgG

Target Details

Product details Application Details Handling Images back to top
Antigen
Alternative Name EXOC7 (EXOC7 Antibody Abstract)
Background Gene Symbol: EXOC7
Gene ID 23265
Pathways Peptide Hormone Metabolism, ER-Nucleus Signaling, Synaptic Vesicle Exocytosis

Application Details

Product details Target Details Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product details Target Details Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product details Target Details Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Exocyst Complex Component 7 (EXOC7) antibody (ABIN4309743) Western Blot: EXOC7 Antibody [NBP1-84767] - Lane 1: NIH-3T3 cell lysate (Mouse embryo...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Exocyst Complex Component 7 (EXOC7) antibody (ABIN4309743) Immunohistochemistry-Paraffin: EXOC7 Antibody [NBP1-84767] - Staining of human breast...
Immunofluorescence (IF) image for anti-Exocyst Complex Component 7 (EXOC7) antibody (ABIN4309743) Immunocytochemistry/Immunofluorescence: EXOC7 Antibody [NBP1-84767] - Staining of hum...