anti-Mouse (Murine) PAX6 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended PAX6 Antibody (supplied by: Log in to see )

Antigen
Paired Box 6 (PAX6) Antibodies
  • pax6
  • an2
  • mgda
  • wagr
  • pax-6
  • pax6a
  • xpax6
  • XLPAX6
  • MGC52531
  • PAX-6
  • AN
  • AN2
  • D11S812E
  • MGDA
  • WAGR
  • Pax-6
  • pax6b
  • 1500038E17Rik
  • AEY11
  • Dey
  • Gsfaey11
  • Sey
  • PAXZF-A
  • Pax6.1
  • cb280
  • fc20e07
  • pax-a
  • pax[zf-a]
  • paxzfa
  • wu:fc20e07
  • zfpax-6a
  • zfpax-6b
  • paired box 6
  • paired box 6 L homeolog
  • paired box 6 S homeolog
  • paired box 6a
  • PAX6
  • pax6
  • Pax6
  • pax6.L
  • pax6.S
  • pax6a
Reactivity
Human, Mouse (Murine), Rat (Rattus)
237
100
87
34
11
8
7
6
6
5
5
4
4
3
2
2
1
1
1
1
Host
Mouse
131
111
16
2
Clonality
Monoclonal
Conjugate
This PAX6 antibody is un-conjugated
10
10
10
9
9
7
3
3
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
193
116
90
76
53
44
43
18
13
8
4
4
3
2
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5663223
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN3043379 IHC (p) WB Rabbit IgG AA 195-233, Middle Region Log in to see Polyclonal 0
1 ABIN1387454 IF (p) IHC (p) WB Rabbit IgG AA 54-103 Log in to see Polyclonal 0
1 ABIN1407788 IHC (p) WB HRP Rabbit IgG AA 54-103 Log in to see Polyclonal 0
1 ABIN1389895 IHC (p) WB Biotin Rabbit IgG AA 54-103 Log in to see Polyclonal 0
1 ABIN4343866 IHC (p) Mouse IgG1 kappa AA 1-300, N-Term Log in to see PAX6-496 0
1 ABIN1818559 IHC (p) WB Rabbit Log in to see Polyclonal 0
1 ABIN4952067 IHC (p) WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen Paired Box 6 (PAX6) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(237), (100), (87), (34), (11), (8), (7), (6), (6), (5), (5), (4), (4), (3), (2), (2), (1), (1), (1), (1)
Host Mouse
(131), (111), (16), (2)
Clonality (Clone)
Monoclonal   ( )
Conjugate This PAX6 antibody is un-conjugated
(10), (10), (10), (9), (9), (7), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(193), (116), (90), (76), (53), (44), (43), (18), (13), (8), (4), (4), (3), (2), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-PAX6 Antibody

Target Details PAX6 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Protein A purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: VSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCMLPTSPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGLISPGVSVPVQVPGSEPDMSQYW
Clone CL5414
Isotype IgG1

Target Details PAX6

Product Details anti-PAX6 Antibody Application Details Handling Images back to top
Antigen
Alternative Name Pax6 (PAX6 Antibody Abstract)
Background Gene Symbol: PAX6
Gene ID 5080
Pathways Peptide Hormone Metabolism, Carbohydrate Homeostasis

Application Details

Product Details anti-PAX6 Antibody Target Details PAX6 Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PAX6 Antibody Target Details PAX6 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-PAX6 Antibody Target Details PAX6 Application Details Handling back to top
Supplier Images
Immunofluorescence (Cultured Cells) (IF (cc)) image for anti-Paired Box 6 (PAX6) antibody (ABIN5663223) Immunocytochemistry/Immunofluorescence: Pax6 Antibody (CL5414) - Staining of HEK 293...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Paired Box 6 (PAX6) antibody (ABIN5663223) Immunohistochemistry-Paraffin: Pax6 Antibody (CL5414) - Staining of mouse embryo E11...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Paired Box 6 (PAX6) antibody (ABIN5663223) Immunohistochemistry-Paraffin: Pax6 Antibody (CL5414) - Staining of mouse embryo E14...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Paired Box 6 (PAX6) antibody (ABIN5663223) Immunohistochemistry-Paraffin: Pax6 Antibody (CL5414) - Staining of rat eye retina s...