anti-Human RBM4B antibody for Immunohistochemistry

Recommended RBM4B Antibody (supplied by: Log in to see )

Antigen
RNA Binding Motif Protein 4B (RBM4B) Antibodies
  • RBM30
  • RBM4L
  • ZCCHC15
  • ZCCHC21B
  • ZCRB3B
  • 4921506I22Rik
  • AI504630
  • AI506404
  • Lark2
  • rbm4
  • rbm30
  • rbm4l
  • zcrb3b
  • zcchc15
  • MGC75893
  • RBM4B
  • RNA binding motif protein 4B
  • RNA binding motif protein 4B L homeolog
  • RNA-binding protein 4B
  • RBM4B
  • Rbm4b
  • rbm4b
  • rbm4b.L
  • LOC713553
  • LOC102180196
  • LOC100058729
Epitope
C-Term
1
1
1
Reactivity
Human
10
6
6
2
2
2
1
1
1
1
1
1
Host
Rabbit
10
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
10
6
3
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN630027
$ 388.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.973637 ABIN2776587 IHC WB Rabbit C-Term Log in to see Polyclonal 0
7 ABIN202338 IHC IHC (p) WB Rabbit IgG AA 290-339 Log in to see Polyclonal 0
4 ABIN2462313 IHC ELISA WB Rabbit Log in to see Polyclonal 0
0.86024475 ABIN4349632 IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
-5.1397552 ABIN4349630 IHC IHC (p) WB Rabbit C-Term Log in to see Polyclonal 0

General

Antigen RNA Binding Motif Protein 4B (RBM4B) Antibodies
Epitope C-Term
(1), (1), (1)
Reactivity Human
(10), (6), (6), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Host Rabbit
(10)
Clonality
Polyclonal
Application Immunohistochemistry (IHC), Western Blotting (WB)
(10), (6), (3), (2), (1)
Supplier Log in to see

Product Details anti-RBM4B Antibody

Target Details RBM4B Application Details Handling Images
Specificity RBM4 B antibody was raised against the C terminal of RBM4
Purification Purified
Immunogen RBM4 B antibody was raised using the C terminal of RBM4 corresponding to a region with amino acids AAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSL
Plasmids, Primers & others

Target Details RBM4B

Product Details anti-RBM4B Antibody Application Details Handling Images back to top
Antigen
Alternative Name RBM4B (RBM4B Antibody Abstract)
Background RBM4B contains 1 CCHC-type zinc finger and 2 RRM (RNA recognition motif) domains. It may play a role in alternative splice site selection during pre-mRNA processing.
Molecular Weight 39 kDa (MW of target protein)
Pathways Photoperiodism

Application Details

Product Details anti-RBM4B Antibody Target Details RBM4B Handling Images back to top
Application Notes WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Comment

RBM4B Blocking Peptide, catalog no. 33R-1001, is also available for use as a blocking control in assays to test for specificity of this RBM4B antibody

Restrictions For Research Use only

Handling

Product Details anti-RBM4B Antibody Target Details RBM4B Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM0 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product Details anti-RBM4B Antibody Target Details RBM4B Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-RNA Binding Motif Protein 4B (RBM4B) (C-Term) antibody (ABIN630027) RBM4B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to s...
Western Blotting (WB) image for anti-RNA Binding Motif Protein 4B (RBM4B) (C-Term) antibody (ABIN630027) RBM4B antibody used at 2.5 ug/ml to detect target protein.