anti-Human LAMTOR2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended LAMTOR2 Antibody (supplied by: Log in to see )

Antigen
Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) Antibodies
  • ENDAP
  • HSPC003
  • MAPBPIP
  • MAPKSP1AP
  • ROBLD3
  • Ragulator2
  • p14
  • 2010111E04Rik
  • AL022628
  • Mapbpip
  • P14
  • Rab25
  • Robld3
  • robld3
  • zgc:100811
  • mapbpip
  • RGD1562501
  • late endosomal/lysosomal adaptor, MAPK and MTOR activator 2
  • LAMTOR2
  • Lamtor2
  • lamtor2
Reactivity
Human
38
20
18
Host
Rabbit
38
Clonality
Polyclonal
Conjugate
This LAMTOR2 antibody is un-conjugated
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
24
19
17
13
9
5
2
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4350844
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN5690038 ELISA IF IHC (p) WB Rabbit IgG AA 40-90 Log in to see Polyclonal 0
1 ABIN657261 IHC (p) WB Rabbit Ig Fraction AA 41-70, Center Log in to see Polyclonal 0
1 ABIN4350843 ICC IF IHC IHC (p) Rabbit AA 1-125, N-Term Log in to see Polyclonal 0
1 ABIN1810344 IHC IHC (p) WB Rabbit AA 41-70 Log in to see Polyclonal 0
1 ABIN1712086 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal 0
1 ABIN1701069 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal 0
1 ABIN1714571 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN5587092 IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN3200988 ICC IF IHC (p) Rabbit AA 1-125, N-Term Log in to see Polyclonal 0

General

Antigen Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) Antibodies
Reactivity Human
(38), (20), (18)
Host Rabbit
(38)
Clonality
Polyclonal
Conjugate This LAMTOR2 antibody is un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(24), (19), (17), (13), (9), (5), (2)
Supplier Log in to see

Product Details anti-LAMTOR2 Antibody

Target Details LAMTOR2 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEP
Isotype IgG
Plasmids, Primers & others

Target Details LAMTOR2

Product Details anti-LAMTOR2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name ROBLD3 (LAMTOR2 Antibody Abstract)
Background Gene Symbol: LAMTOR2
Gene ID 28956
Pathways PI3K-Akt Signaling

Application Details

Product Details anti-LAMTOR2 Antibody Target Details LAMTOR2 Handling Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-LAMTOR2 Antibody Target Details LAMTOR2 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-LAMTOR2 Antibody Target Details LAMTOR2 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) antibody (ABIN4350844) Immunocytochemistry/Immunofluorescence: ROBLD3 Antibody [NBP1-87951] - Staining of hu...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) antibody (ABIN4350844) Immunohistochemistry-Paraffin: ROBLD3 Antibody [NBP1-87951] - Staining of human stoma...
Western Blotting (WB) image for anti-Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) antibody (ABIN4350844) Western Blot: ROBLD3 Antibody [NBP1-87951] - Lane 1: Marker [kDa] 250, 130, 95, 72, 5...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) antibody (ABIN4350844) Immunohistochemistry-Paraffin: ROBLD3 Antibody [NBP1-87951] - Staining of human colon...
Immunofluorescence (IF) image for anti-Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) antibody (ABIN4350844) Immunocytochemistry/Immunofluorescence: ROBLD3 Antibody - Immunofluorescent staining...