anti-Human NCF1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended NCF1 Antibody (supplied by: Log in to see )

Antigen
Neutrophil Cytosol Factor 1 (NCF1) Antibodies
  • NCF1A
  • NOXO2
  • SH3PXD1A
  • p47phox
  • Ncf-1
  • p47
  • neutrophil cytosolic factor 1
  • NCF1
  • Ncf1
Reactivity
Human
241
103
89
14
13
11
11
7
5
1
1
Host
Rabbit
216
42
1
Clonality
Polyclonal
Conjugate
This NCF1 antibody is un-conjugated
7
7
7
4
4
4
2
2
2
2
2
2
2
2
2
2
2
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
213
144
131
49
35
27
14
12
12
6
2
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4338258
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
10.026257 ABIN750643 IF (p) IHC (p) WB Rabbit IgG AA 165-210 Log in to see Polyclonal 0
10.026257 ABIN337093 ELISA IF IHC IHC (p) WB Goat AA 378-390 Log in to see Polyclonal 0
10.026257 ABIN337271 IHC IHC (p) WB Rabbit IgG N-Term Log in to see Polyclonal 0
10.026257 ABIN4338255 ICC IF IHC IHC (p) WB Rabbit IgG Center Log in to see Polyclonal 0
10.026257 ABIN5611556 EIA IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal 0
10.026257 ABIN498263 IF IHC (p) WB Rabbit Log in to see Polyclonal 0
10.026257 ABIN4338259 IHC IHC (p) Rabbit IgG Log in to see Polyclonal 0
1 ABIN652063 IHC (p) WB Rabbit Ig Fraction AA 26-52, N-Term Log in to see Polyclonal 0
1 ABIN372580 EIA IHC (p) WB Goat IgG C-Term Log in to see Polyclonal 0
1 ABIN2878785 ELISA IHC IHC (p) WB Rabbit IgG AA 341-390 Log in to see Polyclonal 0
1 ABIN2855524 ICC IF IHC (p) WB Rabbit IgG Center Log in to see Polyclonal 0
1 ABIN256632 ELISA IHC (p) WB Goat C-Term Log in to see Polyclonal 1
1 ABIN2889156 ELISA IHC IHC (p) WB Rabbit IgG AA 311-360 Log in to see Polyclonal 0
1 ABIN2888918 ELISA IHC IHC (p) WB Rabbit IgG AA 331-380 Log in to see Polyclonal 0
1 ABIN2888916 ELISA IF IHC IHC (p) Rabbit IgG AA 301-350 Log in to see Polyclonal 0
1 ABIN5531686 IHC (p) WB Rabbit Ig Fraction AA 26-52, N-Term Log in to see Polyclonal 0
1 ABIN317896 IHC (p) WB Rabbit Log in to see Polyclonal 0
1 ABIN1387732 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 1
1 ABIN5584259 IHC (p) WB Rabbit pSer345 Log in to see Polyclonal 0
1 ABIN1737778 IHC (p) ELISA WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen Neutrophil Cytosol Factor 1 (NCF1) Antibodies
Reactivity Human
(241), (103), (89), (14), (13), (11), (11), (7), (5), (1), (1)
Host Rabbit
(216), (42), (1)
Clonality
Polyclonal
Conjugate This NCF1 antibody is un-conjugated
(7), (7), (7), (4), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(213), (144), (131), (49), (35), (27), (14), (12), (12), (6), (2)
Supplier Log in to see

Product Details anti-NCF1 Antibody

Target Details NCF1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: YMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENHQ
Isotype IgG
Plasmids, Primers & others

Target Details NCF1

Product Details anti-NCF1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name NCF1 (NCF1 Antibody Abstract)
Background Gene Symbol: NCF1
Gene ID 653361
UniProt P14598
Pathways PI3K-Akt Signaling

Application Details

Product Details anti-NCF1 Antibody Target Details NCF1 Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-NCF1 Antibody Target Details NCF1 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-NCF1 Antibody Target Details NCF1 Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Neutrophil Cytosol Factor 1 (NCF1) antibody (ABIN4338258) Immunohistochemistry-Paraffin: NCF1 Antibody [NBP2-33502] - Immunohistochemical stain...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Neutrophil Cytosol Factor 1 (NCF1) antibody (ABIN4338258) Immunohistochemistry-Paraffin: NCF1 Antibody [NBP2-33502] - liver
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Neutrophil Cytosol Factor 1 (NCF1) antibody (ABIN4338258) Immunohistochemistry-Paraffin: NCF1 Antibody [NBP2-33502] - liver cancer
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Neutrophil Cytosol Factor 1 (NCF1) antibody (ABIN4338258) Immunohistochemistry-Paraffin: NCF1 Antibody - Staining of human spleen shows high e...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Neutrophil Cytosol Factor 1 (NCF1) antibody (ABIN4338258) Immunohistochemistry-Paraffin: NCF1 Antibody - Staining in human spleen and cerebral...