anti-Mouse (Murine) PPP2R3A antibody for Immunofluorescence

Recommended PPP2R3A Antibody (supplied by: Log in to see )

Protein Phosphatase 2, Regulatory Subunit B'', alpha (PPP2R3A) Antibodies
  • PPP2R3
  • PR130
  • PR72
  • 3222402P14Rik
  • A730042E07
  • PPP2R3A
  • Ppp2r3a
  • protein phosphatase 2 regulatory subunit B''alpha
  • protein phosphatase 2, regulatory subunit B'', alpha
  • protein phosphatase 2 regulatory subunit B, alpha S homeolog
  • serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha
  • PPP2R3A
  • Ppp2r3a
  • ppp2r3a.S
  • LOC100088744
  • LOC100478108
  • ppp2r3a
  • LOC100547843
  • LOC100729010
Human, Mouse (Murine), Rat (Rattus)
This PPP2R3A antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4347100
Contact our Customer Service for availability and price in your country.


Antigen Protein Phosphatase 2, Regulatory Subunit B'', alpha (PPP2R3A) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(83), (36), (35), (3), (3), (2), (2), (2), (1), (1)
Host Rabbit
(52), (32)
Conjugate This PPP2R3A antibody is un-conjugated
(5), (5), (5), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(40), (27), (26), (17), (17), (3), (3), (2)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-PPP2R3A Antibody

Target Details PPP2R3A Application Details Handling References for anti-PPP2R3A antibody (ABIN4347100) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EQRDPFAVQKDVENDGPEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKSNKILSASLPEKCGKLQSVDEE
Isotype IgG
Plasmids, Primers & others

Target Details PPP2R3A

Product Details anti-PPP2R3A Antibody Application Details Handling References for anti-PPP2R3A antibody (ABIN4347100) Images back to top
Alternative Name PPP2R3A (PPP2R3A Antibody Abstract)
Background Gene Symbol: PPP2R3A
Gene ID 5523
Pathways PI3K-Akt Signaling

Application Details

Product Details anti-PPP2R3A Antibody Target Details PPP2R3A Handling References for anti-PPP2R3A antibody (ABIN4347100) Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-PPP2R3A Antibody Target Details PPP2R3A Application Details References for anti-PPP2R3A antibody (ABIN4347100) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-PPP2R3A antibody (ABIN4347100)

Product Details anti-PPP2R3A Antibody Target Details PPP2R3A Application Details Handling Images back to top
Product cited in:

DeGrande, Little, Nixon, Wright, Snyder, Dun, Murphy, Kilic, Higgins, Binkley, Boyden, Carnes, Anderson, Hund, Mohler: "Molecular mechanisms underlying cardiac protein phosphatase 2A regulation in heart." in: The Journal of biological chemistry, Vol. 288, Issue 2, pp. 1032-46, 2013


Product Details anti-PPP2R3A Antibody Target Details PPP2R3A Application Details Handling References for anti-PPP2R3A antibody (ABIN4347100) back to top
Supplier Images
Western Blotting (WB) image for anti-Protein Phosphatase 2, Regulatory Subunit B'', alpha (PPP2R3A) antibody (ABIN4347100) Western Blot: PPP2R3A Antibody [NBP1-87233] - Lane 1: Marker [kDa] 230, 130, 95, 72, ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Protein Phosphatase 2, Regulatory Subunit B'', alpha (PPP2R3A) antibody (ABIN4347100) Immunohistochemistry-Paraffin: PPP2R3A Antibody [NBP1-87233] - Staining of human hipp...
Immunofluorescence (IF) image for anti-Protein Phosphatase 2, Regulatory Subunit B'', alpha (PPP2R3A) antibody (ABIN4347100) Immunocytochemistry/Immunofluorescence: PPP2R3A Antibody [NBP1-87233] - Staining of h...
Western Blotting (WB) image for anti-Protein Phosphatase 2, Regulatory Subunit B'', alpha (PPP2R3A) antibody (ABIN4347100) Western Blot: PPP2R3A Antibody - Analysis in human cell lines A-431 and HeLa. Corres...
Western Blotting (WB) image for anti-Protein Phosphatase 2, Regulatory Subunit B'', alpha (PPP2R3A) antibody (ABIN4347100) Western Blot: PPP2R3A Antibody - Analysis in mouse cell line NIH-3T3 and rat cell li...
Western Blotting (WB) image for anti-Protein Phosphatase 2, Regulatory Subunit B'', alpha (PPP2R3A) antibody (ABIN4347100) Western Blot: PPP2R3A Antibody - Lane 1: Marker 230, 130, 95, 72, 56, 36, 28, 17, 1...