anti-Human Cysteine-serine-Rich Nuclear Protein 1 antibody for Immunocytochemistry

Recommended Cysteine-serine-Rich Nuclear Protein 1 Antibody (supplied by: Log in to see )

Cysteine-serine-Rich Nuclear Protein 1 (CSRNP1) Antibodies
  • AXUD1
  • CSRNP-1
  • FAM130B
  • TAIP-3
  • URAX1
  • 4931429D10Rik
  • Axud1
  • taip-3
  • CSRNP1
  • axud1
  • MGC145297
  • fb73e11
  • wu:fb73e11
  • zgc:66340
  • cysteine and serine rich nuclear protein 1
  • cysteine-serine-rich nuclear protein 1
  • cysteine-serine-rich nuclear protein 1 L homeolog
  • cysteine-serine-rich nuclear protein 1b
  • CSRNP1
  • Csrnp1
  • csrnp1
  • csrnp1.L
  • csrnp1b
Immunocytochemistry (ICC), Immunofluorescence (IF)
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN5075204
Contact our Customer Service for availability and price in your country.


Antigen Cysteine-serine-Rich Nuclear Protein 1 (CSRNP1) Antibodies
Reactivity Human
(46), (23), (23), (2), (2), (2), (1), (1), (1), (1)
Host Rabbit
(39), (7)
Conjugate Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(30), (13), (12), (10), (6), (5), (2), (2), (1)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FAQEQARARHEKLRQRLKEEKLEMLQWKLSAAGVPQAEAGLPPVVDAIDDASVEEDLAVAVAGGRLEEVS
Isotype IgG

Target Details

Product details Application Details Handling Images back to top
Alternative Name AXUD1 (CSRNP1 Antibody Abstract)
Background Gene Symbol: CSRNP1
Gene ID 64651
Pathways Platelet-derived growth Factor Receptor Signaling

Application Details

Product details Target Details Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product details Target Details Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product details Target Details Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Cysteine-serine-Rich Nuclear Protein 1 (CSRNP1) antibody (ABIN5075204) Immunocytochemistry/Immunofluorescence: AXUD1 Antibody - Staining of human cell line...