anti-Human Cysteine-serine-Rich Nuclear Protein 1 antibody for Immunofluorescence

Recommended Cysteine-serine-Rich Nuclear Protein 1 Antibody (supplied by: Log in to see )

Antigen
Cysteine-serine-Rich Nuclear Protein 1 (CSRNP1) Antibodies
  • axud1
  • CSRNP1
  • AXUD1
  • MGC145297
  • CSRNP-1
  • FAM130B
  • TAIP-3
  • URAX1
  • 4931429D10Rik
  • Axud1
  • taip-3
  • cysteine-serine-rich nuclear protein 1
  • AXIN1 up-regulated 1
  • csrnp1
  • CSRNP1
  • AXUD1
  • axud1
  • LOC100354183
  • Csrnp1
Reactivity
Human
44
20
20
2
2
2
1
1
1
1
Host
Rabbit
34
10
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF)
28
13
10
5
5
3
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5075204
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.68939 ABIN2562045 IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2882991 IF IHC WB Rabbit IgG Log in to see Polyclonal

General

Antigen Cysteine-serine-Rich Nuclear Protein 1 (CSRNP1) Antibodies
Reactivity Human
(44), (20), (20), (2), (2), (2), (1), (1), (1), (1)
Host Rabbit
(34), (10)
Clonality
Polyclonal
Conjugate Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(28), (13), (10), (5), (5), (3), (2), (2), (1)
Supplier Log in to see

Product details

Target details Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FAQEQARARHEKLRQRLKEEKLEMLQWKLSAAGVPQAEAGLPPVVDAIDDASVEEDLAVAVAGGRLEEVS
Isotype IgG

Target details

Product details Application Details Handling Images back to top
Antigen
Alternative Name AXUD1 (CSRNP1 Antibody Abstract)
Background Gene Symbol: CSRNP1
Gene ID 64651
Research Area Cell Cycle, Chromatin and Nuclear Signaling, Apoptosis/Necrosis
Pathways Platelet-derived growth Factor Receptor Signaling

Application Details

Product details Target details Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product details Target details Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product details Target details Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Cysteine-serine-Rich Nuclear Protein 1 (CSRNP1) antibody (ABIN5075204) Immunocytochemistry/Immunofluorescence: AXUD1 Antibody - Staining of human cell line...