anti-Rat (Rattus) HIP1 antibody for Western Blotting

Recommended HIP1 Antibody (supplied by: Log in to see )

Antigen
Huntingtin Interacting Protein 1 (HIP1) Antibodies
  • CG10971
  • Dmel\\CG10971
  • Hip1R
  • hip1
  • MGC78813
  • HIP-I
  • ILWEQ
  • 2610109B09Rik
  • A930014B11Rik
  • E130315I21Rik
  • mKIAA4113
  • huntingtin interacting protein 1
  • Huntingtin interacting protein 1
  • huntingtin interacting protein 1 related L homeolog
  • HIP1
  • Hip1
  • hip1r.L
  • hip1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
57
12
8
3
3
2
2
2
1
1
1
Host
Rabbit
34
25
Clonality
Polyclonal
Conjugate
This HIP1 antibody is un-conjugated
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
57
23
23
9
9
5
2
1
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4317501
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN5514846 WB Rabbit C-Term Log in to see Polyclonal 0
1 ABIN2605935 WB Rabbit C-Term Log in to see Polyclonal 0
1 ABIN1387494 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1087259 IHC ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN330980 WB Mouse IgG1, kappa Log in to see 0
1 ABIN5697862 ELISA IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN3059342 IHC WB Rabbit Log in to see Polyclonal 0

General

Antigen Huntingtin Interacting Protein 1 (HIP1) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(57), (12), (8), (3), (3), (2), (2), (2), (1), (1), (1)
Host Rabbit
(34), (25)
Clonality
Polyclonal
Conjugate This HIP1 antibody is un-conjugated
(1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(57), (23), (23), (9), (9), (5), (2), (1), (1), (1), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-HIP1 Antibody

Target Details HIP1 Application Details Handling References for anti-HIP1 antibody (ABIN4317501) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NFLRASALSEHISPVVVIPAEASSPDSEPVLEKDDLMDMDASQQNLFDNKFDDIFGSSFSSDPFNFNSQNGVNKDEKDHLIERLYREISGLKAQLENMKTESQRVVLQLKGHVSELEADLAEQQHLRQQAADDCEFLRAELDELRRQRED
Isotype IgG

Target Details HIP1

Product Details anti-HIP1 Antibody Application Details Handling References for anti-HIP1 antibody (ABIN4317501) Images back to top
Antigen
Alternative Name HIP1 (HIP1 Antibody Abstract)
Background Gene Symbol: HIP1
Gene ID 3092
Pathways Positive Regulation of Endopeptidase Activity

Application Details

Product Details anti-HIP1 Antibody Target Details HIP1 Handling References for anti-HIP1 antibody (ABIN4317501) Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-HIP1 Antibody Target Details HIP1 Application Details References for anti-HIP1 antibody (ABIN4317501) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-HIP1 antibody (ABIN4317501)

Product Details anti-HIP1 Antibody Target Details HIP1 Application Details Handling Images back to top
Product cited in:

Majeed, Vasudevan, Chen, Luo, Torres, Evans, Sharkey, Foraker, Wong, Esk, Freeman, Moffett, Keen, Brodsky: "Clathrin light chains are required for the gyrating-clathrin recycling pathway and thereby promote cell migration." in: Nature communications, Vol. 5, pp. 3891, 2014

Images

Product Details anti-HIP1 Antibody Target Details HIP1 Application Details Handling References for anti-HIP1 antibody (ABIN4317501) back to top
Supplier Images
Immunofluorescence (IF) image for anti-Huntingtin Interacting Protein 1 (HIP1) antibody (ABIN4317501) Immunocytochemistry/Immunofluorescence: HIP1 Antibody [NBP1-81592] - Staining of huma...
Western Blotting (WB) image for anti-Huntingtin Interacting Protein 1 (HIP1) antibody (ABIN4317501) Western Blot: HIP1 Antibody [NBP1-81592] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Huntingtin Interacting Protein 1 (HIP1) antibody (ABIN4317501) Immunohistochemistry-Paraffin: HIP1 Antibody [NBP1-81592] - Staining of human epididy...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Huntingtin Interacting Protein 1 (HIP1) antibody (ABIN4317501) Immunohistochemistry-Paraffin: HIP1 Antibody - Staining of human testis shows cytopl...
Western Blotting (WB) image for anti-Huntingtin Interacting Protein 1 (HIP1) antibody (ABIN4317501) Western Blot: HIP1 Antibody - Analysis in human cell lines A-549 and Caco-2 using An...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Huntingtin Interacting Protein 1 (HIP1) antibody (ABIN4317501) Immunohistochemistry-Paraffin: HIP1 Antibody - Analysis in human testis and liver ti...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Huntingtin Interacting Protein 1 (HIP1) antibody (ABIN4317501) Immunohistochemistry-Paraffin: HIP1 Antibody - Staining in human testis and liver ti...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Huntingtin Interacting Protein 1 (HIP1) antibody (ABIN4317501) Immunohistochemistry-Paraffin: HIP1 Antibody - Staining of human liver shows low exp...