anti-Human CCL19 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended CCL19 Antibody (supplied by: Log in to see )

Antigen
Chemokine (C-C Motif) Ligand 19 (CCL19) Antibodies
  • CKb11
  • ELC
  • MIP-3b
  • MIP3B
  • SCYA19
  • CCL19
  • Scya19
  • exodus-3
  • C-C motif chemokine ligand 19
  • chemokine (C-C motif) ligand 19
  • CCL19
  • ccl19
  • Ccl19
Reactivity
Human
134
35
23
3
1
1
Host
Rabbit
84
66
15
Clonality
Polyclonal
Conjugate
This CCL19 antibody is un-conjugated
16
9
8
6
5
5
5
5
4
4
3
3
3
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
91
80
64
25
17
16
13
12
11
5
5
5
4
3
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5075558
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
13.042537 ABIN4288750 IHC IHC (fro) IHC (p) WB Mouse IgG2 Log in to see MM0143-11B4 0
1 ABIN740505 IF (p) IHC (p) Rabbit IgG AA 60-100 Log in to see Polyclonal 1
1 ABIN1499472 ELISA IHC IHC (p) WB Mouse kappa, IgG1 Log in to see 0
1 ABIN2618135 IHC IHC (p) Mouse IgG1 AA 22-98 Log in to see 4F3 0
1 ABIN2618133 IHC IHC (p) Mouse IgG1 AA 22-98 Log in to see 2A12 0
1 ABIN740514 IHC (p) HRP Rabbit IgG AA 60-100 Log in to see Polyclonal 0
1 ABIN740507 IHC (p) Biotin Rabbit IgG AA 60-100 Log in to see Polyclonal 0
1 ABIN5948218 IHC IHC (fro) IHC (p) Janelia Fluor® 549 Mouse IgG2 Log in to see MM0143-11B4 0
1 ABIN5948219 IHC IHC (fro) IHC (p) Janelia Fluor® 646 Mouse IgG2 Log in to see MM0143-11B4 0
1 ABIN5600726 IHC IHC (fro) IHC (p) WB Alexa Fluor 405 Mouse IgG2 Log in to see MM0143-11B4 0
1 ABIN5600729 IHC IHC (fro) IHC (p) WB Alexa Fluor 700 Mouse IgG2 Log in to see MM0143-11B4 0
1 ABIN5600733 IHC IHC (fro) IHC (p) WB DyLight 488 Mouse IgG2 Log in to see MM0143-11B4 0
1 ABIN5600737 IHC IHC (fro) IHC (p) WB DyLight 755 Mouse IgG2 Log in to see MM0143-11B4 0
1 ABIN5600735 IHC IHC (fro) IHC (p) WB DyLight 650 Mouse IgG2 Log in to see MM0143-11B4 0
1 ABIN5600738 IHC IHC (fro) IHC (p) FITC Mouse IgG2 Log in to see MM0143-11B4 0
1 ABIN5600727 IHC IHC (fro) IHC (p) WB Alexa Fluor 488 Mouse IgG2 Log in to see MM0143-11B4 0
1 ABIN5600728 IHC IHC (fro) IHC (p) WB Alexa Fluor 647 Mouse IgG2 Log in to see MM0143-11B4 0
1 ABIN5600730 IHC IHC (fro) IHC (p) WB Biotin Mouse IgG2 Log in to see MM0143-11B4 0
1 ABIN5600731 IHC IHC (fro) IHC (p) WB DyLight 350 Mouse IgG2 Log in to see MM0143-11B4 0
1 ABIN5600732 IHC IHC (fro) IHC (p) WB DyLight 405 Mouse IgG2 Log in to see MM0143-11B4 0

General

Antigen Chemokine (C-C Motif) Ligand 19 (CCL19) Antibodies
Reactivity Human
(134), (35), (23), (3), (1), (1)
Host Rabbit
(84), (66), (15)
Clonality
Polyclonal
Conjugate This CCL19 antibody is un-conjugated
(16), (9), (8), (6), (5), (5), (5), (5), (4), (4), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(91), (80), (64), (25), (17), (16), (13), (12), (11), (5), (5), (5), (4), (3), (1), (1), (1)
Supplier Log in to see

Product Details anti-CCL19 Antibody

Target Details CCL19 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Isotype IgG
Plasmids, Primers & others

Target Details CCL19

Product Details anti-CCL19 Antibody Application Details Handling Images back to top
Antigen
Alternative Name CCL19/MIP-3 beta (CCL19 Antibody Abstract)
Background Gene Symbol: CCL19
Gene ID 6363
Pathways Positive Regulation of Immune Effector Process

Application Details

Product Details anti-CCL19 Antibody Target Details CCL19 Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:500 - 1:1000This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-CCL19 Antibody Target Details CCL19 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-CCL19 Antibody Target Details CCL19 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Chemokine (C-C Motif) Ligand 19 (CCL19) antibody (ABIN5075558) Immunocytochemistry/Immunofluorescence: CCL19/MIP-3 beta Antibody - Immunohistochemi...
Immunohistochemistry (IHC) image for anti-Chemokine (C-C Motif) Ligand 19 (CCL19) antibody (ABIN5075558) Immunohistochemistry: CCL19/MIP-3 beta Antibody - Immunohistochemical staining of hu...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Chemokine (C-C Motif) Ligand 19 (CCL19) antibody (ABIN5075558) Immunohistochemistry-Paraffin: CCL19/MIP-3 beta Antibody - Staining of human cerebra...