anti-Human BRISC and BRCA1 A Complex Member 1 antibody for Western Blotting

Recommended BRISC and BRCA1 A Complex Member 1 Antibody (supplied by: Log in to see )

Antigen
BRISC and BRCA1 A Complex Member 1 (BABAM1) Antibodies
  • merit40
  • nba1
  • zgc:100909
  • c19orf62
  • C19orf62
  • MERIT40
  • NBA1
  • C7H19orf62
  • 5430437P03Rik
  • Merit40
  • BRISC and BRCA1 A complex member 1
  • BRISC and BRCA1 A complex member 1 L homeolog
  • babam1
  • BABAM1
  • babam1.L
  • Babam1
Epitope
N-Term
10
10
7
4
3
2
2
1
1
1
1
1
Reactivity
Human
36
5
4
2
2
2
1
1
Host
Rabbit
29
4
2
1
Clonality
Polyclonal
Conjugate
Un-conjugated
2
2
2
2
2
2
Application
Western Blotting (WB)
34
20
19
7
4
3
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN632802
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
10.842518 ABIN652514 FACS IHC (p) WB Rabbit Ig Fraction AA 116-143, Center Log in to see Polyclonal 1
10.842518 ABIN949228 IF WB Mouse AA 1-329 Log in to see Polyclonal 0
10 ABIN6749759 IHC IHC (p) WB Rabbit IgG AA 36-85 Log in to see Polyclonal 0
10 ABIN5536292 FACS IHC (p) WB Rabbit Ig Fraction AA 116-143 Log in to see Polyclonal 0
9.342518 ABIN2785989 WB Rabbit N-Term Log in to see Polyclonal 1
7.842518 ABIN652513 IHC (p) WB Rabbit Ig Fraction AA 9-37, N-Term Log in to see Polyclonal 0
7.842518 ABIN453692 EIA IHC (p) WB Rabbit Middle Region Log in to see Polyclonal 1
7.842518 ABIN526065 IF WB Mouse AA 1-329 Log in to see Polyclonal 0
7.842518 ABIN3003809 IHC WB Rabbit IgG Log in to see Polyclonal 0
4.842518 ABIN6268202 ELISA WB Rabbit IgG pSer29 Log in to see Polyclonal 0
4.842518 ABIN6268618 ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1832261 IHC WB Sheep IgG AA 182-329 Log in to see Polyclonal 0
1 ABIN2589685 IF WB Mouse IgG AA 1-329 Log in to see Polyclonal 0
1 ABIN2286598 IHC ELISA WB Rabbit IgG N-Term, AA 16-45 Log in to see Polyclonal 0
1 ABIN2286599 ELISA WB Rabbit IgG Center Log in to see Polyclonal 0
1 ABIN1974481 IHC ELISA WB PE Rabbit IgG AA 9-37 Log in to see Polyclonal 0
1 ABIN1963446 IHC ELISA WB APC Rabbit IgG AA 9-37 Log in to see Polyclonal 0
1 ABIN1969893 IHC ELISA WB FITC Rabbit IgG AA 9-37 Log in to see Polyclonal 0
1 ABIN1972145 IHC ELISA WB HRP Rabbit IgG AA 9-37 Log in to see Polyclonal 0
1 ABIN1961070 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG AA 9-37 Log in to see Polyclonal 0

General

Antigen BRISC and BRCA1 A Complex Member 1 (BABAM1) Antibodies
Epitope N-Term
(10), (10), (7), (4), (3), (2), (2), (1), (1), (1), (1), (1)
Reactivity Human
(36), (5), (4), (2), (2), (2), (1), (1)
Host Rabbit
(29), (4), (2), (1)
Clonality
Polyclonal
Conjugate Un-conjugated
(2), (2), (2), (2), (2), (2)
Application Western Blotting (WB)
(34), (20), (19), (7), (4), (3), (1), (1)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Specificity C19 ORF62 antibody was raised against the N terminal Of C19 rf62
Purification Affinity purified
Immunogen C19 ORF62 antibody was raised using the N terminal Of C19 rf62 corresponding to a region with amino acids DRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIR

Target Details

Product details Application Details Handling Images back to top
Antigen
Alternative Name C19ORF62 (BABAM1 Antibody Abstract)
Background C19orf62 is a component of the BRCA1-A complex, a complex that specifically recognises 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs).
Molecular Weight 36 kDa (MW of target protein)
Pathways Positive Regulation of Response to DNA Damage Stimulus

Application Details

Product details Target Details Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

C19ORF62 Blocking Peptide, catalog no. 33R-2140, is also available for use as a blocking control in assays to test for specificity of this C19ORF62 antibody

Restrictions For Research Use only

Handling

Product details Target Details Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF62 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product details Target Details Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-BRISC and BRCA1 A Complex Member 1 (BABAM1) (N-Term) antibody (ABIN632802) C19ORF62 antibody used at 1 ug/ml to detect target protein.