anti-Human NUP153 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended NUP153 Antibody (supplied by: Log in to see )

Antigen
Nucleoporin 153kDa (NUP153) Antibodies
  • CG4453
  • Dmel\\CG4453
  • NUP153
  • Nup 153
  • dNup153
  • dmNup153
  • nup153
  • NUCZINK
  • B130015D15Rik
  • C88147
  • HNUP153
  • N153
  • Nucleoporin 153
  • nucleoporin 153kDa
  • nucleoporin 153
  • nucleoporin Nup153
  • Nup153
  • NUP153
  • LOC100232758
  • nup153
Reactivity
Human
41
13
7
3
2
2
1
1
1
1
1
1
1
Host
Rabbit
38
5
2
1
Clonality
Polyclonal
Conjugate
This NUP153 antibody is un-conjugated
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
34
15
14
12
8
7
5
5
3
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4341163
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
13.671394 ABIN4341161 ICC IF IHC IHC (p) Rabbit IgG Log in to see Polyclonal
13.671394 ABIN4341162 ICC IF IHC IHC (p) Rabbit IgG Log in to see Polyclonal
1 ABIN5584853 IF IHC (p) Rabbit IgG Log in to see Polyclonal
1 ABIN5584851 IF IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN5584852 IF IHC (p) Rabbit IgG Log in to see Polyclonal

General

Antigen Nucleoporin 153kDa (NUP153) Antibodies
Reactivity Human
(41), (13), (7), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Host Rabbit
(38), (5), (2), (1)
Clonality
Polyclonal
Conjugate This NUP153 antibody is un-conjugated
(2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(34), (15), (14), (12), (8), (7), (5), (5), (3), (1), (1)
Supplier Log in to see

Product Details anti-NUP153 Antibody

Target Details NUP153 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GQNREQRESGFSYPNFSLPAANGLSSGVGGGGGKMRRERTRFVASKPLEEEEMEVPVLPKISLPITSSSLPTFNFSSPEITTSSPSPINSSQALTNKVQMTSP
Isotype IgG

Target Details NUP153

Product Details anti-NUP153 Antibody Application Details Handling Images back to top
Antigen
Alternative Name Nup153 (NUP153 Antibody Abstract)
Background Gene Symbol: NUP153
Gene ID 9972
Research Area Chromatin and Nuclear Signaling
Pathways Protein targeting to Nucleus

Application Details

Product Details anti-NUP153 Antibody Target Details NUP153 Handling Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-NUP153 Antibody Target Details NUP153 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-NUP153 Antibody Target Details NUP153 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Nucleoporin 153kDa (NUP153) antibody (ABIN4341163) Western Blot: Nup153 Antibody [NBP1-81725] - Lane 1: Marker [kDa] 230, 130, 95, 72, 5...
Immunofluorescence (IF) image for anti-Nucleoporin 153kDa (NUP153) antibody (ABIN4341163) Immunocytochemistry/Immunofluorescence: Nup153 Antibody [NBP1-81725] - Staining of hu...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Nucleoporin 153kDa (NUP153) antibody (ABIN4341163) Immunohistochemistry-Paraffin: Nup153 Antibody [NBP1-81725] - Staining of human cereb...