AP2M1 Protein (AA 1-435, full length) (GST tag)
-
- Target See all AP2M1 Proteins
- AP2M1 (Adaptor-Related Protein Complex 2, mu 1 Subunit (AP2M1))
- Protein Type
- Recombinant
- Protein Characteristics
- AA 1-435, full length
-
Origin
- Human
-
Source
- Escherichia coli (E. coli)
- Purification tag / Conjugate
- This AP2M1 protein is labelled with GST tag.
- Application
- SDS-PAGE (SDS), ELISA, Western Blotting (WB)
- Sequence
- MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHAR QQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFE FLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGY PQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIG WRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRV VMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQS IAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTT KDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKI EVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAG MKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLK VRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC
- Purity
- 95 %
- Top Product
- Discover our top product AP2M1 Protein
-
-
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Buffer
- 6M guanidine hydrochloride, 20mM Tris
- Storage
- 4 °C
-
- Target
- AP2M1 (Adaptor-Related Protein Complex 2, mu 1 Subunit (AP2M1))
- Alternative Name
- AP-2 complex subunit mu (AP2M1 Products)
- Synonyms
- AP50 Protein, CLAPM1 Protein, mu2 Protein, Ap50 Protein, Clapm1 Protein, cb34 Protein, Ap2m1 Protein, dpy-23 Protein, sb:cb34 Protein, zgc:55711 Protein, zgc:85653 Protein, wu:fa97a10 Protein, ap2m1-a Protein, ap2m1 Protein, zgc:56643 Protein, AP2M1 Protein, adaptor related protein complex 2 mu 1 subunit Protein, adaptor-related protein complex 2, mu 1 subunit Protein, adaptor-related protein complex 2, mu 1 subunit, a Protein, adaptor related protein complex 2 mu 1 subunit L homeolog Protein, adaptor-related protein complex 2, mu 1 subunit, b Protein, AP-2 complex subunit mu-1 Protein, clathrin coat assembly protein AP50 Protein, clathrin coat assembly protein ap50 Protein, AP2M1 Protein, Ap2m1 Protein, ap2m1a Protein, ap2m1.L Protein, ap2m1b Protein, ap2m1 Protein, cgd8_950 Protein, PY06523 Protein, PVX_118455 Protein, PVX_123590 Protein, CpipJ_CPIJ003697 Protein
- Background
- Background: Component of the adaptor protein complex 2 (AP-2). Adaptor protein complexes function in protein transport via transport vesicles in different membrane traffic pathways. Adaptor protein complexes are vesicle coat components and appear to be involved in cargo selection and vesicle formation. AP-2 is involved in clathrin-dependent endocytosis in which cargo proteins are incorporated into vesicles surrrounded by clathrin (clathrin-coated vesicles, CCVs) which are destined for fusion with the early endosome. The clathrin lattice serves as a mechanical scaffold but is itself unable to bind directly to membrane components. Clathrin-associated adaptor protein (AP) complexes which can bind directly to both the clathrin lattice and to the lipid and protein components of membranes are considered to be the major clathrin adaptors contributing the CCV formation. AP-2 also serves as a cargo receptor to selectively sort the membrane proteins involved in receptor-mediated endocytosis. AP-2 seems to play a role in the recycling of synaptic vesicle membranes from the presynaptic surface. AP-2 recognizes Y-X-X-[FILMV] (Y-X-X-Phi) and [ED]-X-X-X-L-[LI] endocytosis signal motifs within the cytosolic tails of transmembrane cargo molecules. AP-2 may also play a role in maintaining normal post-endocytic trafficking through the ARF6-regulated, non-clathrin pathway. The AP-2 mu subunit binds to transmembrane cargo proteins, it recognizes the Y-X-X-Phi motifs. The surface region interacting with to the Y-X-X-Phi motif is inaccessible in cytosolic AP-2, but becomes accessible through a conformational change following phosphorylation of AP-2 mu subunit at 'Tyr-156' in membrane-associated AP-2. The membrane-specific phosphorylation event appears to involve assembled clathrin which activates the AP-2 mu kinase AAK1 By similarity. Plays a role in endocytosis of frizzled family members upon Wnt signaling. Synonyms: Alternative name(s): AP-2 mu chain Adapter-related protein complex 2 mu subunit Adaptin-mu2 Adaptor protein complex AP-2 subunit mu Clathrin assembly protein complex 2 medium chain Clathrin coat assembly protein AP50 Clathrin coat-associated protein AP50 HA2 50 kDa subunit Plasma membrane adaptor AP-2 50 kDa protein.
- Molecular Weight
- 77 kD
- NCBI Accession
- NM_004068
- UniProt
- Q96CW1
- Pathways
- EGFR Signaling Pathway, Neurotrophin Signaling Pathway, EGFR Downregulation, SARS-CoV-2 Protein Interactome
-